Home
Patent Search
IMT Blog
REGISTER
|
SIGN IN
United States Patent
5821123
Studnicka
October 13, 1998
Title
Modified antibody variable domains
Abstract
Methods are described for identifying the amino acid residues of an antibody variable domain which may be modified without diminishing the native affinity of the domain for antigen while reducing its immunogenicity with respect to a heterologous species and for preparing so modified antibody variable domains which are useful for administration to heterologous species. Antibody variable regions prepared by the methods of the invention are also described.
Inventors:
Studnicka; Gary M.
(Santa Monica,
CA
)
Assignee:
XOMA Corporation
(Berkeley,
CA
)
Appl. No.:
477531
Filed:
June 7, 1995
Current U.S. Class:
435/328
435/343.1
435/343.2
530/387.3
530/388.1
530/388.22
530/388.7
530/391.3
530/391.7
536/23.1
536/23.53
424/133.1
424/134.1
424/135.1
424/143.1
424/144.1
424/152.1
424/153.1
424/154.1
424/178.1
424/183.1
424/188.1
435/320.1
Field of Search:
435/69.1,71.1 424/133.1 530/71.1
U.S. Patent Documents
4391904
July 1983
Litman et al.
4816397
March 1989
Boss et al.
4816567
March 1989
Cabilly et al.
4853871
August 1989
Pantoliano et al.
4888415
December 1989
Lambert et al.
4925673
May 1990
Steiner et al.
4946778
August 1990
Ladner et al.
5101025
March 1992
Piatak, Jr. et al.
5225539
July 1993
Winter
5585089
December 1996
Queen et al.
Foreign Patent Documents
0 120 694 A2
Oct., 1984
EP
0 125 023 A1
Nov., 1984
EP
0 125 023 B1
Jun., 1991
EP
0 173 494 A2
Mar., 1986
EP
0 239 400 A2
Sep., 1987
EP
0 440 351 A2
Aug., 1991
EP
0 451 216 B1
Jan., 1996
EP
0 519 596 A1
Dec., 1992
EP
0 592 106 A1
Apr., 1994
EP
2177096
May., 1989
GB
2188638
Oct., 1987
GB
WO 86/01533
Mar., 1986
WO
WO 89/00999
Feb., 1989
WO
WO 89/01783
Mar., 1989
WO
WO 89/09622
Oct., 1989
WO
WO 90/07861
Jul., 1990
WO
WO 92/04380
Mar., 1992
WO
WO 92/07075
Apr., 1992
WO
WO 92/15327
Sep., 1992
WO
WO 92/22324
Dec., 1992
WO
WO 92/22653
Dec., 1992
WO
WO 93/05168
Mar., 1993
WO
Other References
Ahmed, BioEssay, 6(4): 175-177 "Structure and Function of Chimaeric Antibodies". .
Alegre et al., J. Immunol., 148(11): 3461-3468 (1992) "Effect of a Single Amino Acid Mutation on the Activating and Immunosuppressive Properties of a Humanized OKT3 Monoclonal Antibody". .
Antin, et al., Blood, 78(8): 2139-2149 (1991) "Selective Depletion of Bone Marrow T Lymphocytes With Anti-CD5 Monoclonal Antibodies: Effective Prophylaxis for Graft-Versus-Host Disease in Patients With Hematologic Malignancies". .
Barry, Dermatological Formulations p. 181 (1983) "Percutaneous Absorption". .
Better, et al., Science, 240: 1041-1043 (1988) "Escherichia coli Secretion of an Active Chimeric Antibody Fragment". .
Better et al., J. Biol. Chem., 267(23): 16712-16718 (1992) "Activity of Recombinant Mitogillin and Mitogillin Immunoconjugates". .
Better et al., Proc Natl. Acad. Sci. USA, 90: 457-461 (1993) "Potent Anti-CD5 Ricin A Chain Immunoconjugates from Bacterially Produced Fab' and F(ab')2". .
Bird et al., Science, 242: 423-426 (1988) "Single-Chain Antigen-Binding Proteins". .
Bolt et al., Eur. J. Immunol, 23(2): 403-411 (1993) "The Generation of a Humanized, Non-Mitogenic CD3 Monoclonal Antibody Which Retains In Vitro Immunosuppressive Properties". .
Borrebaeck et al., Bio/Technology, "Kinetic Analysis of Recombinant Antibody-Antigen Interactions: Relation Between Structural Domains and Antigen Binding" 10(6):697-698. .
Boulianne et al., Nature, 312: 643-646 (1984) "Production of Fuctional Chimeric Mouse/Human Antibody". .
Brady et al., J. Mol. Biol., 227: 253-264 (1992) "Crystal Structure of a Chimeric Fab' Fragment of an Antibody Binding Tumour Cells". .
Brown et al., Proc. Natl. Acad. Sci. USA, 88: 2663-2667 (1991) "Anti-Tac-H, a Humanized Antibody To The Interleukin 2 Receptor, Prolongs Primate Cardiac Allograft Survival". .
Bruggemann et al., J. Exp. Med., 170: 2153-2157 (1989) "The Immunogenicity of Chimeric Antibodies". .
Buchner et al., Biotechnology, 9: 157-162 (1991) "Renaturation, Purification and Characterization of Recombinant F.sub.ab -Fragments Produced in Escherichia Coli". .
Byers et al., Blood, 75(7): 1426-1432 (1990) "Use of An Anti-Pan T-Lymphocyte Ricin A Chain Immunotoxin in Steriod-Resistant Acute Graft-Versus-Host Disease". .
Caron et al., Cancer Res., 52(24): 6761-6767 (1992) "Biological and Immunological Features of Humanized Mi95 (Anti-CD33) Monoclonal Antibodies". .
Carter et al., Proc. Natl. Acad. Sci. USA, 89: 4285-4289 (1992) "Humanization of Anti-p185.sup.HER2 Antibody for Human Cancer Therapy". .
Case et al., Proc. Natl. Acad. Sci. USA, 86: 287-291 (1989) "Chimeric Cytotoxin IL2-PE40 Delays and Mitigates Adjuvant-Induced Arthritis in Rats". .
Cheadle et al., Mol. Immunol., 29: 21-30 (1992) "Cloning and Expression of the Variable Regions of Mouse Myeloma Protein MOPC315 in E. Coli: Recovery of Active F.sub.v Fragments". .
Chothia et al., The EMBO Journal, 7(12): 3745-3755 (1988) "The Outline Structure of the T-Cell .alpha..beta. Receptor". .
Chothia et al., J. Mol. Biol., 196: 901-917 (1987) "Canonical Structures for the Hypervariable Regions of Immunoglobulins". .
Chothia et al., Nature, 342: 877-883 (1989) "Conformations of Immunoglobulin Hypervariable Regions". .
Chothia et al., J. Mol. Biol., 186: 651-663 (1985) "Domain Association in Immunoglobulin Molecules, The Packing of Variable Domains". .
Chothia and Lesk, Cold Spring Harbor Symp. Quant. Biol., 52: 399-405 (1987) "The Evolution of Protein Structures". .
Choy et al., Scandinavian J. Immunol., 36: 291-298 (1992) "Treatment of Rheumatoid Arthritis With Single Dose or Weekly Pulses of Chimaeric Anti-CD4 Monoclonal Antibody". .
Co et al., Nature, 351: 501-502 (1991) "Humanized Antibodies for Therapy". .
Co et al., Proc. Natl. Acad. Sci. USA, 88: 2869-2873 (1991) "Humanized Antibodies for Antiviral Therapy". .
Co et al., J. Immunol., 148: 1149-1154 (1992) "Chimeric and Humanized Antibodies with Specificity for the CD33 Antigen". .
Daugherty, et al., Nucleic Acids Res., 19: 2471-2476 (1991) "Polymerase Chain Reaction Facilitates the Cloning, CDR-grafting, and Rapid Expression of a Murine Monoclonal Antibody Directed Against the CD18 Component of Leukocyte Integrins". .
Davies & Metzger, Ann. Rev. Immunol., 1: 87-117 (1983) "Structural Basis of Antibody Function". .
Davies and Padlan, Ann. Rev. Biochem., 59: 439-473 (1990) "Antibody-Antigen Complexes". .
Derocq et al., Transplantation, 44(6): 763-769 (1987) "Rationale for the Selection of Ricin A-Chain Anti-T Immunotoxins for Mature T Cell Depletion". .
Eigenbrot et al., J. Mol. Biol., 229: 969-995 (1993) "X-ray Structures of the Antigen-binding Domains from Three Variants of Humanized Anti-p185.sup.HER3 Antibody 4D5 and Comparison with Molecular Modeling". .
Ey et al., Immunochem., 15: 429-436 (1978) "Isolation of pure IgG.sub.1, and IgG.sub.2a and IgG.sub.2b Immunoglobulins from Mouse Serum Using Proteins A-Sepharose". .
Fishwild et al., Clin. Exp. Immunol., 86: 506-513 (1991) "Cytotoxicity Against Human Peripheral Blood Mononuclear Cells and T Cells Lines Mediated By Anti-T Cell Immunotoxins in the Absence of Added Potentiator". .
Fishwild et al., Clin. Exp. Immunol., 97: 10-18 (1994) "Characterization of the Increased Cytotoxicity of Gelonin Anti-T Cell Immunoconjugates Compared with Ricin A Immunoconjugates". .
Foote et al., J. Mol. Biol., 224: 487-499 (1992) "Antibody Framework Residues Affecting the Conformation of Hypervariable Loops". .
Galfre et al., Nature, 266: 550-552 (1977) "Antibodies to Major Histocompatibility Antigens Produced by Hybrid Cell Lines". .
Glaser et al., J. Immunol., 149(8): 2607-2614 (1992) "Dissection of the Combining Site in a Humanized Anti-Tac Antibody". .
Glockshuber et al., Biochemistry, 29: 1362-1367 (1990) "A Comparison of Strategies to Stabilize Immunoglobulin F.sub.v -Fragments". .
Goff et al., Bioconjugate Chem., 1: 381-386 (1990) "Substituted 2-Iminothiolanes: Reagents for the Preparation of Disulfide Cross-Linked Conjugates With Increased Stability". .
Goldberg et al., J. Autoimmunity, 4: 617-630 (1991) "Immunological Effects of High Dose Administration of Anti-CD4 Antibody In Rheumatoid Arthritis Patients". .
Goldberg et al., Arthritis and Rheumatism, 33: S153, Abstract D115 (1990) "Preliminary Trial of an Anti-CD4 Monoclonal Antibody (MoAb) in Rheumatoid Artritis (RA)". .
Gorman et al., Proc. Natl. Acad. Sci. USA, 88: 4181-4185 (1991) "Reshaping a Therapeutic CD4 Antibody". .
Hafler et al., Neurology, 36: 777-784 (1986) "Immunologic Responses of Progressive Multiple Sclerosis Patients Treated With An Anti-T-Cell Monoclonal Antibody, Anti-T12". .
Hakimi et al., J. Immunol., 147: 1352-1359 (1991) "Reduced Immunogenicity and Improved Pharmacokinetics Of Humanized Anti-Tac in Cynomolgus Monkeys". .
Hakimi et al., J. Immunol., 151: 1075 (1993) "Humanized Mik.beta.1, A Humanized Antibody to the IL-2 Receptor .beta.-chain That Acts Synergistically With Humanized Anti-TAC". .
Hale et al., The Lancet, 11: 1394-1399 (1988) "Remission Induction in Non-Hodgkin Lymphoma With Reshaped Human Monoclonal Antibody Campath-1H". .
Hara et al., Clinical Immunology and Immunopathology, 49: 223-230 (1988) "Stimulatory Effect of CD5 Antibody on B Cells from Patients With Rheumatoid Arthritis". .
Harlow et al., Eds., Antibodies: A Laboratory Manual, Chapter 14, "Immunoassays", Cold Spring Harbor Laboratory, Cold Spring Harbor (1988). .
Hodgson, Biotechnology, 8: 1245-1247 (1990) "Protein Design: Rules, Empiricism, & Nature". .
Horneff et al., Arthritis and Rheumatism, 34(2): 129-140 (1991) "Treatment of Rheumatoid Arthritis With An Anti-CD4 Monoclonal Antibody". .
Hsiao et al., Antibody Engineering Meeting, Dec. 14-16, 1992, Abstract "Humanization of Anti-CD18 mAb 60.3". .
Huse et al., Science, 246: 1275-1281 (1989) "Generation of a Large Combinatorial Library of the Immunoglobulin Repertoire in Phage Lambda". .
Huston et al., Proc. Natl. Acad. Sci. USA, 85: 5879-5883 (1988) "Protein Engineering of Antibody Binding Sites: Recovery of Specific Activity in an Anti-Digoxin Single-Chain Fv Analogue Produced in Escherichia coli". .
Janin et al., J. Biol. Chem., 265: 16027-16030 (1990) "The Structure of Protein Recognition Sites". .
Jones et al., Biotechnology, 9: 88-89 (1991) "Rapid PCR Cloning of Full-Length Mouse Immunoglobulin Variable Regions". .
Jones et al., Nature, 321: 522-525 (1986) "Replacing the Complementarity-Determining Regions in a Human Antibody with those from a Mouse". .
Junghans et al., Cancer Res., 50 (5): 1495-1502 (1990) "Anti-Tac-H, A Humanized Antibody to the Interleukin 2 Receptor with New Features for Immunotherapy in Malignant and Immune Disorders". .
Kabat et al., J. Biol. Chem., 252 (19): 6609-6616 (1977) "Unusual Distributions of Amino Acids in Complementarity-Determining (Hypervariable) Segments of Heavy and Light Chains of Immunglobulins and their Possible Roles in Spectificity of Antibody-Combining Sites". .
Kelley et al., Biochem., 32: 6828-6835 (1993) "Thermodynamic Analysis of an Antibody Functional Epitope". .
Kelley et al., Biochem., 31: 5434-5441 (1992) "Antigen Binding Theromdynamics and Antiproliferative Effects of Chimeric and Humanized Anti-p185.sup.HER2 Antibody Fab Fragments". .
Kernan et al., J. Immunol., 133 (1): 137-146 (1984) Specific Inhibition of in vitro Lymphocte Transformation by an Anti-Pan T Cell (gp67) Ricin A Chain Immunotoxin. .
Kettleborough et al., Protein Engineering, 4: 773-783 (1991) "Humanization of a Mouse Monoclonal Antibody by CDR-Grafting: The Importance of Framework Residues on Loop Comformation". .
Kirkham et al., Brit. J. Rheumatology, 30: 88 Abstract 16 (1991) "Chimaeric (Human/Mouse) CD7 Monoclonal Antibody Treatment in Rheumatoid Arthritis". .
Kirkahm et al., Brit. J. Rheumatology, 30: 459-463 (1991) "Monoclonal Antibody Treatment in Rheumatoid Arthritis: The Clinical and Immunological Effects of a CD7 Monoclonal Antibody". .
Kirkham et al., J. Rheumatology, 19: 1348-1352 (1992) "Chimeric CD7 Monoclonal Antibody Therapy in Rheumatoid Arthritis". .
Knowles, Chapter 22 in Reinherz et al., Leukocyte Typing II, 1: 259-288 (Springer-Verlag, 1986) "Immunochemical Analysis of the T-Cell Specific Antigens". .
Koda et al., Hum. Antibody Hybridomas 1(1): 15-22 (1990) Review "In Vitro Immunization for the Production of Human Monoclonal Antibody". .
Kohler et al., Eur. J. Immunol., 6: 292-295 (1976) "Fusion Between Immunoglobulin-Secreting and Nonsecreting Myeloma Cell Lines". .
Kyle et al., J. Rheumatol., 18: 1737-1738 "Humanized Monoclonal Antibody Treatment in Rheumatoid Arthritis". .
Lambert et al., J. Biol. Chem., 246: 12035-12041 (1985) "Purified Immunotoxins that are Reactive with Human Lymphoid Cells". .
Laurent et al., Bone Marrow Transplantation. 4: 367-371 (1989) "Donor Bone Marrow Treatment With Treatment With T101 Fab Fragment-Ricin A-Chain Immunotoxin Prevents Grafts-Versus-Host Disease". .
Lazarovits et al., J. Immunol., 150(11): 5163-5174 (1993) "Human Mouse Chimeric CD7 Monoclonal Antibody (SDZCHH380) for the Prophylaxis of Kidney Transplant Rejection". .
Lesk et al., Nature, 335: 188-190 (1988) "Elbow Motion in the Immunoglobulins Involves a Molecular Ball-and-socket Joint". .
Liu et al., Gene, 54: 33-40 (1987) "Expression of Mouse: Human Immunoglobulin in Heavy-Chain cDNA in Lymphoid Cells". .
LoBuglio et al., Proc. Natl. Acad. Sci. USA, 86: 4220-4224 (1989) "Mouse/Human Chimeric Monoclonal Antibody in a Man: Kinetics and Immune Response". .
Marks et al., J. Mol. Biol., 222: 581-597 (1991) "By-Passing Immunization: Human Antibodies from V-Gene Libraries Displayed on Phage". .
Marks et al., J. Biol. Chem., 267(23): 16007-16010 (1992) "Molecular Evolution of Proteins on Filamentous Phage". .
Martin et al., Proc. Natl. Acad. Sci. USA, 86: 9268-9272 (1989) "Modeling Antibody Hypervariable Loops: A Combined Algorithm". .
Mathieson et al., New England J. Med., 323 (4): 250-254 (1990) "Monoclonal-Antibody Therapy in Systemic Vasculitis". .
McCafferty et al., Nature, 248: 552-554 (1990) "Phage Antibodies: Filamentous Phage Displaying Antibody Variable Domains". .
Miglietta, et al., Antibody Engineering Meeting, Dec. 14-16, 1992 Abstract "Alternation of Framework Residues Modulate Binding of a CDR-Grafted Anti-Human ICAM-1". .
Morrison, Science, 229: 1202-1207 (1985) "Transfectomas Provide Novel Chimeric Antibodies". .
Morrison et al., Adv. im Immunol., 44: 65-92 (1989) "Genetically Engineered Antibody Molecules". .
Morrison et al., Proc. Natl. Acad. Sci., 81: 6851-6855 (1984) "Chimeric Human Anitbody Molecules: Mouse Antigen-Binding Domains With Human Constant Region Domains". .
Munson et al., Anal. Biochem., 107: 220-239 (1980) "Ligand: A Versatile Computerized Approach for Characterization of Ligand-Binding Systems". .
Near et al., J. Immunol., 146 (2): 627-633 (1991) "The Spectificity Properties that Distinguish Members of a Set of Homologous Anti-Digoxin Antibodies are Controlled by H Chain Mutations". .
Nishimura et al., Eur. J. Immunol., 18: 747-753 (1988) "Expression and Function of a CD5 cDNA in Human and Murine T Cells". .
Nisonoff et al., Archives of Biochem., 93 460-462 (1961) "Recombination of a Mixture of Univalent Antibody Fragments of Different Specificity". .
Novotny et al., Proc. Natl. Acad. Sci. USA, 82: 4592-4596 (1985) "Structural Invariants of Antigen Binding: Comparison of Immunoglobulin V.sub.L -V.sub.H and V.sub.L -V.sub.L Domain Dimers". .
Novotny et al., J. Mol. Biol., 189: 715-721 (1986) "Location of Antigenic Epitopes on Antibody Molecules". .
Novotny et al., Proc. Natl. Acad. Sci. USA, 83: 226-230 (1986) "Antigenic Determinants in Proteins Coincide with Surface regions Accessible to Large Probes (Antibody Domains)". .
Novotny et al., Proc. Natl. Acad. Sci. USA, 83: 742-746 (1986) "Secondary, Tertiary, and Quaternary structure of T-cell-specific Immunoglobulin-like Polypeptide Chains". .
Padlan et al., Proc. Natl. Acad. Sci. USA, 86: 5938-5942 (1989) "Structure of an Antibody-Antigen Complex: Crystal Structure of the HyHEL-10 Fab-lysozyme Complex". .
Padlan, E.A. Molecular Immunology, 28(4/5): 489-498 (1991) "A Possible Procedure For Reducing The Immunogenicity of Antibody Variable Domains While Preserving Their Ligand-Binding Properties". .
Peacock et al., Arthritis and Rheumatology, 35 (Suppl.) Abstract No. B141 (1992) "An Angiogenesis Inhibitor in Combination with Anti-CD5 mab Suppresses Established Collagen Induced Arthritis Significantly More Than Single Agent Therapy". .
Pluckthun, Biotechnology, 9: 545-551 (1991) "Antibody Engineering: Advances From the Use of Escherichia coli Expression Systems". .
Potter et al., Proc. Natl. Acad. Sci. USA, 81: 7161-7165 (1984) "Enhancer-dependent Expression of Human K Immunoglobulin Genes Introduced into Mouse pre-B Lymphocytes by Electroporation". .
Presta et al., J. Immunol, 151: 2623-2632 (1993) "Humanization of an antibody Directed Against IgE". .
Queen et al., Proc. Natl. Acad. Sci. USA, 86: 10029-10033 (1989) "A Humanized Antibody that Binds to the Interleukin 2 Receptor". .
Racadot et al., Brit. J. Rheumatology, 30: 88 (1991) Abstract "Immunological Follow Up of 13 Patients With Rheumatoid Arthritis Treated by Anti-T CD4+ Monoclonal Anitbodies". .
Riechmann et al., Nature, 332: 323-327 (1988) "Reshaping Human Antibodies for Therapy". .
Roberts et al., Nature, 328: 731-734 (1987) "Generation of an Antibody with Enhanced Affinity and Specificty for Its Antigen by Protein Engineering". .
Robinson et al., Hum. Antib. Hybridomas, 2: 84-93 (1991) "Chimeric Mouse-Human Anti Carcinoma Antibodies that Mediate Different Anti-Tumor Cell Biological Activities". .
Rodwell, Nature, 342: 99-100 (1989) "Engineering Monoclonal Antibodies". .
Roguska et al., Proc. Natl. Acad. Sci. USA, 91: 969-973 (1994) "Humanization of Murine Monoclonal Antibodies Through Variable Domain Resurfacing". .
Rostaing-Capaillon et al., Cancer Immunol. Immunothor., 34: 24-30 (1991) "in Vivo Cytotoxic Efficacy of Immunotoxins Prepared From Anti-Cd5 Antibody Linked to Ricin A-Chain". .
Routledge et al., Eur. J. Immunol., 21: 2717-2725 (1991) "A Humanized Monovalent CD3 Anitbody which can Activate Homologous Complement". .
Royston et al., J. Immunol. 125(2): 725-731 (1980) "Human T Cell Antigens Defined By Monoclonal Antibodies: The 65,000-Dalton Antigen of T Cells (T65) Is Also Found On Chronic Lymphoctic Leukemia Cells Bearing Surface Immunoglobulin". .
Schlom, J. Molecular Foundations of Oncology, Samuel Broder (Ed.), Williams and Wilkins, Baltimore, MD Chapter 6 pp. 95-134 "Monoclonal Antibodies: They're More And Less Than You Think". .
Sharon et al., Nature, 309: 364-367 (1984) "Expression of a V.sub.h C.sub.k Chimaeric Protein in Mouse Myeloma Cells". .
Shearman et al., Antibody Engineering Meeting, Dec. 10-11, 1990 Abstract "Humanized Antibodies with Spectificity for the Human .alpha./.beta. T Cell Receptor". .
Shearman et al., J. Immunol., 147(12): 4366-4373 (1991) "Contruction, Expression and Characterization of Humanized Anitbodies Directed Against the Human .alpha./.beta. T Cell Receptor". .
Sims et al., J. Immunol., 151(4): 2296-2308 (1993) "A Humanized CD18 Antibody can Block Function Without Cell Destruction". .
Singer et al., J. Immunol., 150: 2844-2857 (1993) "Optimal Humanization of 1B4, An Anti-CD18 Murine Monoclonal Anitbody, Is Achieved by Correct Choice of Human V-Region Framework Sequences". .
Skerra et al., Science, 1038-1041 (1988) "Assembly of a Functional Immunoglobulin F.sub.V Fragments in Escherichia coli". .
Strand et al., Arthritis and Rheumatism, 33 (9 Suppl.)(1990) p. S25 "Treatment of Rheumatoid Arthritis With An Anti-CD5 Immunoconjugate: Clinical And Immunologic Findings and Preliminary Results of Re-Treatment". .
Studnicka, G.M., Biochem J., 252: 825-831 (1988) "Escherichia coli Promoter -10 and -35 Region Hologies Correlate with Binding and Isomerization Kinetics". .
takeda et al., Nature, 314: 452-454 (1985) "Construction of Chimaeric Processed Immunogloblin Genes Containing Mouse Variable and human Constant Region Sequences". .
Tempest et al., Biotechnology, 9: 266-271 (1991) "Reshaping a Human Monoclonal Antibody to inhibit Human Respiratory Synctial Virus infection in vivo". .
Thornton, Nature, 343: 411-412 (1990) "Tackling a Loopy Problems". .
Tramontano et al., J. Mol. Biol., 215: 175-182 (1990) "Framework Residue 71 is Major Determinant of the Position and Conformation of the Second Hypervariable Region in the V.sub.H Domains of Immunglobins". .
Tramontano et al., Proteins: Structure, Function and Genetics, 6: 382-394 (1989) "Structural Determinants of the Conformations of Medium-Sized Loops in Proteins". .
Verhoeyen et al., Science, 239: 1534-1536 (1988) "Reshaping Human Antibodies: Grafting an Antilysozyme Activity". .
Verhoeyen et al., BioEssays, 8(2): 74-78 (1988) "Engineering of Antibodies". .
Vietetta et al., Science, 238: 1098-1104 (1987) "Redesigning Nature's Poisons to Create Anit-Tumor Reagents". .
Ward et al., Nature, 341: 544-546 (1989) "Binding Activities of Repertoire of Single Immunglobulin Variable Domains Secreted from Escherichia coli". .
Winter et al., Nature, 349: 293-299 (1991) "Man-Made Antibodies". .
Wofsky et al., J. Immun., 134(2): 852-857 (1985) "Treatment of Murine Lupus with Monoclonal Anti-T Cell Anitbody". .
Woodle et al., J. Immunol., 148: 2756-2763 (1992) "Humanized OKT3 Antibodies: Successful Transfer of Immune Modulating Properties and Idiotype Expression". .
Wu et al., J. Exp. Med., 132: 211-250 (1970) "An Analysis of Sequences of the Variable Regions of Bence Jones Proteins and Myeloma Light Chains and Their Implications for Antibody Complementarity". .
Wu and Kabat., Mol. Immunol., 29(9): 1141-1146 (1992) "Possible Use of Similar Framework Region Amino Acid Sequences Between Human and Mouse Immunoglobulins for Humanizing Mouse Anitbodies"..~
Primary Examiner:
Scheiner; Toni R.
Assistant Examiner:
Lucas; John
Attorney, Agent or Firm:
McAndrews, Held & Malloy, Ltd.
Parent Case Text
CROSS REFERENCE TO RELATED APPLICATIONS
This application is a continuation of U.S. appl. Ser. No. 08/107,669, filed Aug. 13, 1993, which is the U.S. National Phase of PCT/US92/10906, filed Dec. 14, 1992 , which is a continuation-in-part of U.S. appl. Ser. No. 07/808,464, filed Dec. 13, 1991 (abandoned).
Claims
I claim:
1. DNA comprising DNA encoding the modified light chain variable region amino acid sequence:
DIQMTQSPSSMSASLGDRVTITCRASQDINSYLSWFQQKPGKSPKTLIYRA NRLVDGVPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK (SEQ ID No. 27).
2. DNA comprising DNA encoding the modified heavy chain variable region amino acid sequence:
QIQLVQSGPGLKKPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLRWMGWINTHT GEPTYADDFKGRFTFSLDTSKSTAYLQINSLRAEDTATYFCTRRGYDWYFDVWGQGT TVTVSS (SEQ ID No. 29).
3. DNA comprising DNA encoding the modified light chain variable region amino acid sequence:
4. DNA comprising DNA encoding the modified heavy chain variable region amino acid sequence:
EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHY GEPTYADSFKGTRTFSLDDSKNTAYLQINSLRAEDTAVYFCTRRGYDWYFDVWGQG GTTVTVSS (SEQ ID No.67).
5. DNA comprising (1) a first DNA encoding the modified light chain variable region amino acid sequence:
DIQMTQSPSSMSASLGDRVTITCRASQDINSYLSWFQQKPGKSPKTLIYRANRLV DGVPSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK(SEQ ID No. 27), and
(2) a second DNA encoding the modified heavy chain variable region amino acid sequence:
QIQLVQSGPGLKKPGGSVRISCAASGYTFTNYGMNWVKQAPGKGLRWMGWINTH TGEPTYADDFKGRFTFSLDTSKSTAYLQINSLRAEDTATYFCTRRGYDWYFDVWGQG TTVTVSS (SEQ ID No. 29).
6. DNA comprising (1) a first DNA encoding a modified light chain variable region amino acid sequence:
DIQMTQSPSSLSASVGDRVTITCRASQDINSYLSWFQQKPGKAPKTLIYRANRLESGV PSRFSGSGSGTDYTLTISSLQYEDFGIYYCQQYDESPWTFGGGTKLEIK (SEQ ID No. 65), and (2) a second DNA encoding a modified heavy chain variable region amino acid sequence:
EIQLVQSGGGLVKPGGSVRISCAASGYTFTNYGMNWVRQAPGKGLEWMGWINTHY GEPTYADSFKGTRTFSLDDSKNTAYLQINSLRAEDTAVYFCTRRGYDWYFDVW GQGGTTVTVSS (SEQ ID No. 67).
7. The DNA of any one of claims 1-6 wherein said DNA further comprises DNA encoding a J-segment fused in frame to said variable region.
8. The DNA of any one of claims 1-6, wherein said DNA further comprises DNA encoding one or more constant regions fused in frame to said variable region.
9. The DNA of claim 8, wherein at least one constant region is derived from a different source than the source from which said variable region was derived.
10. The DNA of claim 9, wherein said source from which said constant region is derived is human.
11. A host cell containing the DNA of any one of claims 1-6.
12. A host cell containing the DNA of claim 7.
13. A host cell containing the DNA of claim 8.
14. A host cell containing the DNA of claim 9.
15. A host cell containing the DNA of claim 10.
Description
FIELD OF THE INVENTION
The present invention relates, in general, to methods for preparing a modified antibody variable domain by determining the amino acid residues of the antibody variable domain which may be modified without diminishing the native affinity of the domain for antigen while reducing its immunogenicity with respect to a heterologous species; to methods of preparation of and use of antibody variable domains having modifications at the identified residues which are useful for administration to heterologous species; and to the variable regions so modified. More particularly, the invention relates to the preparation of modified mouse antibody variable domains, which are modified for administration to humans, the resulting antibody variable domains themselves, and the use of such "humanized" antibodies in the treatment of diseases in humans.
BACKGROUND
Application of unmodified mouse monoclonal antibodies in human therapy is problematic for three reasons. First, an immune response against the mouse antibodies is mounted in the human body. Second, the antibodies have a reduced half-life in the human circulatory system. Third, the mouse antibody effector domains may not efficiently trigger the human immune system.
There are three methods which have attempted to eliminate the foregoing problems. Junghans et al., Cancer Res., 50, 1495-1502 (1990) and other publications describe the utilization of genetic engineering techniques to link DNA encoding murine variable regions to DNA encoding human constant regions, creating constructs which when expressed generate a hybrid mouse/human antibody.
Also by genetic engineering techniques, the genetic information from murine hypervariable complementarity determining regions (CDRs) may be inserted in place of the DNA encoding the CDRs of a human monoclonal antibody to generate a construct encoding a human antibody with murine CDRs. This technique is known as "CDR grafting". See, e.g., Jones et al., Nature, 321, 522-525 (1986); Junghans et al., supra.
Protein structure analysis may be used to "add back" murine residues, again by genetic engineering, to first generation variable regions generated by CDR grafting in order to restore lost antigen binding capability. Queen et al., Proc. Natl. Acad. Sci. USA, 86, 10029-10033 (1989); Co, et al., Proc. Natl. Acad. Sci. USA, 88, 2869-2873 (1991) describe versions of this method. The foregoing three methods are techniques to "humanize" mouse monoclonal antibodies.
As a result of the humanization of mouse monoclonal antibodies, specific binding activity of the resulting humanized antibodies may be diminished or even completely abolished. For example, the binding affinity of the modified antibody described in Queen et al., supra, is reported to be reduced three-fold; in Co et al., supra, is reported to be reduced two-fold; and in Jones et al., supra, is reported to be reduced two- to three-fold. Other reports describe order-of-magnitude reductions in binding affinity. See, e.g., Tempest et al., Bio/Technology, 9, 266-271 (1991); Verhoeyen et al., Science, 239, 1534-1536 (1988).
A system for differentiating between the various subsets of T Cells, based upon cell surface antigens, is the Clusters of Differentation System (hereinafter referred to as the "CD System"). The CD System represents standard nomenclature for molecular markers of leukocyte cell differentation molecules. See Leukocyte Typing III White Cell Differentiation Antigens (Michael, ed. Oxford Press 1987), which is incorporated herein by reference.
So-called "pan T cell" markers (or antigens) are those markers which occur on T Cells generally and are not specific to any particular T cell subset(s). Pan T Cell markers include CD2, CD3, CD5, CD6, and CD7. The CD5 cluster antigen, for example, is one of the pan T markers present on about 85-100% of the human mature T lymphocytes and a majority of human thymocytes. CD5 is also present on a subset, about 20%, of B cells. Extensive studies using flow cytometry, immunoperoxidase staining, and red cell lysis have demonstrated that this antigen is not normally present on hematopoietic progenitor cells or on any other normal adult or fetal human tissue with the exception of the aforementioned subpopulation of B cells.
Further information regarding the CD5 marker is found in McMichael and Gotch, in Leukocyte Typing III White Cell Differentiation Antigens (Michael, ed. Oxford Press 1987). The CD5 molecule has also been described in the literature as reactive with immunoglobulins. See, e.g., Kernan et al., J. Immunol., 33:137-146 (1984), which is incorporated herein by reference.
There are reports of attempted treatment of rheumatoid arthritis patients with monoclonal antibodies against CD4. See Horneff, et al. Arthritis and Rheumatism 34:2, 129-140 (February 1991); Goldberg, et al., Arthritis and Rheumatism, Abstract D115, 33:S153 (September 1990); Goldberg, Journal of Autoimmunity, 4:617-630 (1991); Choy, et al. Scand. J. Immunol. 36:291-298 (1992).
There are reports of attempted treatment of autoimmune disease, particularly rheumatoid arthritis, with an anti-CD5 monoclonal antibody. See Kirkham, et al., British Journal of Rheumatology 30:459-463 (1991); Kirkham, et al., British Journal of Rheumatology 30:88 (1991); Kirkham, et al., Journal of Rheumatology 19:1348-1352 (1992). There is also a report of an attempt to treat multiple sclerosis with an anti-T12 antibody. Hafler, et al., Neurology 36:777-784 (1986).
As demonstrated by the foregoing, there exists a need in the art for a method of preparing antibody variable domains by identification of residues in mouse monoclonal variable region domains which may be modified without diminishing the native affinity of the domains for antigen while reducing their immunogenicity with respect to a heterologous species for use in the treatment of diseases.
SUMMARY OF THE INVENTION
The present invention provides methods for preparing a modified antibody variable domain useful for administration to humans by determining the amino acids of a subject antibody variable domain which may be modified without diminishing the native affinity of the domain for antigen while reducing its immmunogenicity with respect to a heterologous species. As used herein, the term "subject antibody variable domain" refers to the antibody upon which determinations are made. The method includes the following steps: determining the amino acid sequence of a subject light chain and a subject heavy chain of a subject antibody variable domain to be modified; aligning by homology the subject light and heavy chains with a plurality of human light and heavy chain amino acid sequences; identifying the amino acids in the subject light and heavy chain sequences which are least likely to diminish the native affinity of the subject variable domain for antigen while, at the same time, reducing its immunogenicity by selecting each amino acid which is not in an interface region of the subject antibody variable domain and which is not in a complementarity-determining region or in an antigen-binding region of the subject antibody variable domain, but which amino acid is in a position exposed to a solvent containing the antibody; changing each residue identified above which aligns with a highly or a moderately conserved residue in the plurality of human light and heavy chain amino acid sequences if said identified amino acid is different from the amino acid in the plurality.
Another group of sequences, such as those in FIGS. 1A and 1B may be used to determine an alignment from which the skilled artisan may determine appropriate changes to make.
The present invention provides a further method wherein the plurality of human light and heavy chain amino acid sequences is selected from the human consensus sequences in FIGS. 5A and 5B.
In general, human engineering according to the above methods may be used to treat various diseases against which monoclonal antibodies generally may be effective. However, humanized antibodies possess the additional advantage of reducing the immunogenic response in the treated patient.
The present invention also discloses products and pharmaceutical compositions useful in the treatment of a myriad human diseases. In particular, products prepared by the foregoing methods include a modified H65 mouse monoclonal variable domain. Additionally, DNA sequences encoding the modified H65 variable domain are provided.
Modified antibody variable domains which are products of the methods of the present invention may be used, inter alia, as components of various immunoglobulin molecules such as Fab, Fab', and F(ab').sub.2 domains, single chain antibodies, and Fv or single variable domains.
Immunoglobulin molecules comprising modified variable domains according to the invention are particularly suited for therapeutic administration to human by themselves or, for example, as components of immunoconjugates such as those described in co-pending, co-owned U.S. patent application Ser. No. 07/787,567 filed on Nov. 4, 1991.
The present invention also provides methods for treatment of autoimmune diseases, wherein animal models are predictive of the efficacy of treatment in humans. Finally, the present invention includes pharmaceutical compositions containing the humanized antibodies according to the invention are disclosed.
BRIEF DESCRIPTION OF THE DRAWING
FIGS. 1A and 1B are alignments of the amino acid sequences of the light and heavy chains, respectively, of four human antibody variable domains [HYH (HYHEL-10 Fab-lysosyme complex), MCPC (IgA Fab MCPC603-phosphocholine complex), NEWM (Ig Fab' NEW) and KOL (IgG1 KOL)) by criteria of sequence and structural homology;
FIG. 2 is a schematic depiction of the structural relationships between the amino acid residues of the light chain of the variable domain;
FIG. 3 is a schematic depiction of the structural relationships between the amino acid residues of the heavy chain of the variable domain;
FIG. 4 is a schematic representation of an antibody variable domain;
FIGS. 5A and 5B are alignments of the consensus amino acid sequences for the subgroups of light [hK1 (human kappa light chain subgroup 1), hK3 (human kappa light chain subgroup 3), hK2 (human kappa light chain subgroup 2), hL1 (human lambda light chain subgroup 1), hL2 (human lambda light chain subgroup 2), HL3 (human lambda light chain subgroup 3), hL6 (human lambda light chain subgroup 6), hK4 (human kappa light chain subgroup 4), hL4 (human lambda light chain subgroup 4) and hL5 (human lambda light chain subgroup 5] and heavy chains [hH3 (human heavy chain subgroup 3), hH1 (human heavy chain subgroup 1) and hH2 (human heavy chain subgroup 2)], respectively, of human antibody variable domains;
FIGS. 6A and 6B are alignments of human light chain consensus sequence hK1 with the actual (h65) and low-risk modified (prop) light chain sequences of the H65 mouse monoclonal antibody variable domain and of human heavy chain consensus sequence hH3 with the actual (h65) and modified (prop) heavy chain sequences of the H65 mouse monoclonal antibody variable domain, respectively;
FIGS. 7A and 7B are listings of the nucleotide sequences of the oligonucleotides utilized in the construction of the genes encoding modified V/J-regions of the light and heavy chains of the H65 mouse monoclonal antibody variable domain;
FIGS. 8A and 8B are listings of the nucleotide sequences of the genes encoding modified V/J-regions of the heavy and light chains, respectively, of the H65 mouse monoclonal antibody variable domain;
FIG. 9 is a graph of the results of a competitive binding assay showing that the H65 antibody variable domain modified by a method according to the present invention retains the antigen-binding capability of the natural H65 antibody variable region;
FIGS. 10A and 10B are alignments of human light chain consensus hK1 and heavy chain consensus hH1 with the light and heavy chain sequences, respectively, of the variable domain of human antibody EU, human antibody TAC, murine antibody TAC modified according to the present invention (prop) and murine antibody TAC modified according to a different method (Que);
FIG. 11 is a graph of He3 IgG binding to CD5 found on Molt-4M, demonstrating that such binding is similar to that of cH65 IgG;
FIG. 12 is a graph showing the effects of anti-Lyt-1 administration on the severity of collagen-induced arthritis in DBA/1J mice;
FIGS. 13A and 13B are depictions of human T cell recovery in spleen and blood, respectively from PBMC/SCID mice following treatment with H65 MoAb;
FIGS. 14A and 14B are schematic depictions of human T cell recovery in spleen and blood, respectively from PBMC/SCID mice following treatment with H65-based F(ab').sub.2 fragment;
FIG. 15 is a graph of the effects of OX19 MoAb on the severity of DR BB rat collagen-induced arthritis; and
FIGS. 16A and 16B are alignments of human light chain consensus sequence hK1 with the actual (h65) and low and moderate risk modified (prop) light chain sequences of the H65 mouse monoclonal antibody variable domain and of human heavy chain consensus sequence hH3 with the actual (h65) and modified (prop) heavy chain sequences of the H65 mouse monoclonal antibody variable domain, respectively.
DETAILED DESCRIPTION
Methods according to the present invention include: (1) identification of the amino acid residues of an antibody variable domain which may be modified without diminishing the native affinity of the domain for antigen while reducing its immunogenicity with respect to a heterologous species; (2) the preparation of antibody variable domains having modifications at the identified residues which are useful for administration to heterologous species; and (3) use of the humanized antibodies of the invention in the treatment of autoimmune diseases in humans. The methods of the invention are based on a model of the antibody variable domain described herein which predicts the involvement of each amino acid in the structure of the domain.
Unlike other methods for humanization of antibodies, which advocate replacement of the entire classical antibody framework regions with those from a human antibody, the methods described herein introduce human residues into the variable domain of an antibody only in positions which are not critical for antigen-binding activity and which are likely to be exposed to immunogenicity-stimulating factors. The present methods are designed to retain sufficient natural internal structure of the variable domain so that the antigen-binding capacity of the modified domain is not diminished in comparison to the natural domain.
Data obtained from the analysis of amino acid sequences of antibody variable regions using the MacImdad (Molecular Applications Group, Stanford, Calif.) three-dimensional molecular modeling program, in conjunction with data obtained from previous theoretical studies of hypervariable region structure, and data obtained from the crystal structures of the HYH (HYHEL-10 Fab-lysosyme complex, Brookhaven structure "3HFM"), MCPC (IgA Fab MCPC603-phosphocholine complex, Brookhaven structure "2MCP"), NEWM (Ig Fab' NEW, Brookhaven structure "3FAB") and KOL (IgG1 KOL, Brookhaven structure "2IG2") antibody variable domains from the Brookhaven database (Brookhaven National Laboratory, Upton, N.Y.). are utilized to develop the antibody variable domain model.
FIGS. 1A and 1B provide the sequences of the four antibody variable domains which have been crystallized. The amino acid sequences of the light and heavy chains of HYH (SEQ ID Nos. 1 and 5, respectively), MCPC (SEQ ID Nos. 2 and 6, respectively), NEWM (SEQ ID Nos. 3 and 7, respectively) and KOL (SEQ ID Nos. 4 and 8, respectively) are shown, wherein the exclamation points "!" in the MCPC light chain sequence at position 30x, the MCPC heavy chain sequence at positions 52x and 98x, the NEWM light chain at position 30x, the KOL light chain at position 93x, and the KOL heavy chain sequence at position 98x, stand for the amino acid sequences NSGNQK (SEQ ID No. 9), NKG (SEQ ID No 10), GST (SEQ ID No 11), AG, SL and HGFCSSASC (SEQ ID No
12), respectively which are variations in the length of hypervariable loop sequences among the various antibodies. FIGS. 2 and 3 comprise depictions of the structure of the light and heavy chains, respectively, wherein each chain is displayed "unfolded" into a flattened beta sheet structure so that interactions among the residues are easier to visualize. The strands of folded polypeptide chains are represented as thick vertical lines, connected by eight beta-turn loops. Three of the loops are identified as antigen-binding loops or CDRs, one is accessory to the loops, and the remaining four at the "bottom" of the variable domain are not involved in antigen binding. The amino and carboxy termini of the variable domain are symbolized by small black dots at the ends of the polypeptide chains. Each amino acid position is represented as either a circle, a triangle, or a square. The covalent disulfide bond between the two cysteines at positions 23 and 88 in the light chain and the covalent disulfide bond between positions 22 and 92 in the heavy chain are each shown as a thick horizontal line. All of the residues in each chain are shown on the map, including antigen-binding residues and framework residues. The amino acid positions are numbered according to Kabat et al., Sequences of Proteins of Immunological Interest, Fourth Edition, U.S. Department of Health and Human Services, Public Health Service, National Institutes of Health (1987), with the exception of those designated with a lower-case "x", which are variations in length of hypervariable loops which Kabat has numbered as "a,b,c,d . . . ". Solid slanted lines (either single or double) connecting pairs of residues which are adjacent in three-dimensional space but not in linear sequence, represent one or two hydrogen bonds between the mutually aligned amino nitrogens and carbonyl oxygens in the backbones of the residues.
The analysis of each amino acid position to determine whether the position influences antigen binding and/or is immunogenic was based upon the information in FIGS. 1A, 1B, 2 and 3, as well as the additional variable region structural information in the following paragraphs.
The basic structure of the antibody variable domain is strongly conserved. The variable domain is composed of a light chain (or subunit) and a heavy chain (or subunit), which are structurally homologous to each other and which are related by a pseudo-two-fold axis of rotational symmetry. At the "top" of the variable domain, the region farthest away from the constant domain, there are six antigen-binding loops which are built upon a larger structural framework region. The variable domain is functionally distinct from the constant domain, being connected only by two highly flexible chains and pivoting on both "ball-and-socket" joints formed by five amino acids in the heavy and light chains.
Each subunit, light or heavy, resembles a "sandwich" structure, composed of two layers of antiparallel beta pleated sheets with a propeller twist in three-dimensional space. Each amino acid chain folds back on itself repeatedly to create nine distinct strands. Three-and-one-half of these strands form the "outside" beta-sheet layer of each subunit and the other five-and-one-half form the "inside" layer. The various strands in each layer are extensively hydrogen-bonded to each other. The two beta-sheet layers within the subunit are held together by a single covalent disulfide bond and by numerous internal hydrophobic interactions. The sequences involved in bonding the strands of the subunits together are called "framework" sequences.
Certain amino acids, either in antigen-binding sequences or in framework sequences, do not actually bind antigen but are critical for determining the spatial conformation of those residues which do bind. Each antigen-binding loop requires a properly formed "platform" of buried residues, which provides a surface upon which the loop folds. One or more of the loop residues often will be buried in the platform as an "anchor" which restricts the conformational entropy of the loop and which determines the precise orientation of antigen-contacting sidechains. Thus, the shapes of the residues which make up the platform contribute to the ultimate shape of the antigen-binding loop and its affinity for specific antigens.
Amino acid sidechains exist in various different chemical environments within the subunits. Some residues are exposed to the solvent on the outer accessible surface while other residues are buried in hydrophobic interactions within a subunit. Much of the immunoglobulin variable domain is constructed from antiparallel beta pleated sheets which create amphipathic surfaces, such that the "inside" surface is hydrophobic and the "outside" surface is hydrophilic. The outside is exposed to solvent, and therefore is also exposed to the humoral environment when the domain is in the circulatory system of an animal. Amino acid sidechains which are completely exposed to the solvent and which do not physically interact with other residues in the variable domain are likely to be immunogenic and are unlikely to have any structural importance within the immunoglobulin molecule. A highly schematic representation of the variable domain is shown in FIG. 4, wherein thick lines represent peptide bonds and shaded circles denote amino acid side chains.
The two subunits of antibody variable domains adhere to each other via a hydrophobic interface region which extends along the inside beta-sheet layer from the border of the variable domain with the constant domain to the antigen-binding loops. Amino acid side chains from both subunits interact to form a three-layered "herringbone" structure. Some of these interfacial residues are components of the antigen-binding loops, and thus have a direct effect upon binding affinity. Every residue in the interface is structurally important because the conformation of the binding regions is strongly influenced by changes in the conformation of the interface.
The foregoing data and information on the structure of antibody variable domains aids in a determination of whether a particular amino acid of any variable domain is likely to influence antigen binding or immunogenicity. The determination for each amino acid position is represented by a pair of symbols (e.g., + and +, in the lines labelled "bind" and "bury", respectively) in FIGS. 1A, 1B, (and also in FIGS. 5A, 5B, 6A, 6B, 10A and 10B). In each of these pairs, the first symbol relates to antigen binding, while the second symbol relates to immunogenicity and framework structure. Tables 1, 2 and 3, below, set out the significance of the symbols and possible pairings.
TABLE 1 ______________________________________ FIRST SYMBOL IN PAIR (LIGAND BINDING) ______________________________________ + Little or no direct influence on antigen- binding loops, low risk if substituted o Indirectly involved in antigen-binding loop structure, moderate risk if changed - Directly involved in antigen-binding loop conformation or antigen contact, great risk if modified ______________________________________
TABLE 2 ______________________________________ SECOND SYMBOL IN PAIR (IMMUNOGENICITY and STRUCTURE) ______________________________________ + Highly accessible to the solvent, high immunogenicity, low risk if substituted o Partially buried, moderate immunogenicity, moderate risk if altered - Completely buried in subunit's hydrophobic core, low immunogenicity, high risk if changed = Completely buried in the interface between subunits, low immunogenicity, high risk if modified. ______________________________________
TABLE 3 ______________________________________ SIGNIFICANCE OF PAIRS ______________________________________ ++ Low risk Highly accessible to the solvent and high immunogenicity, but little or no effect on specific antigen binding o+, +o, oo Moderate risk Slight immunogenicity or indirect involvement with antigen binding any - or = High risk Buried within the subunit core/interface or strongly involved in antigen binding, but little no immunogenic potential ______________________________________
The pairings set out in the Figures indicate that making mouse-to-human modifications at positions which have a pair of low risk symbols (++) (i.e., a symbol in the "bind" line and a symbol in the "bury" line corresponding to one position) results in a major reduction in therapeutic immunogenicity with little chance of affecting binding affinity. At the opposite end of the spectrum, modifying positions which have a pair of high risk symbols (--) may degrade or abolish binding activity with little or no actual reduction in therapeutic immunogenicity. There are 73 low risk positions in the variable domain (38 in the light chain and 35 in the heavy chain) which are indicated by circles in the lines labelled "risk" in FIGS. 1A, 1B, 5A,
5B, 6A, 6B, 10A and 10B. There are 29 moderate risk positions in the variable domain (12 in the light chain and 17 in the heavy chain) as indicated by the triangles in the lines labelled "risk" in FIGS., 1A, 1B, 5A, 5B, 6A, 6B, 10A, and 10B.
The results of the above analysis may be applied to consensus sequences for the different subgroups of antibody variable domains because the structural characteristics they represent are highly conserved, even among various species. FIGS. 5A and
5B thus set out and align the consensus sequences (derived from Kabat et al., supra) of the subgroups of light (hK1, SEQ ID NO: 13; hK3, SEQ ID NO: 14; hK2, SEQ ID NO: 15; hL1 SEQ ID NO: 16; hL2, SEQ ID NO: 17; hL3, SEQ ID NO: 18; hL6, SEQ ID NO: 19; hK4, SEQ ID NO: 20; hL4, SEQ ID NO: 21; and hL5, SEQ ID NO: 22) and heavy chains (hH3, SEQ ID NO: 23; hH1, SEQ ID NO: 24; and hH2, SEQ ID NO: 25) of antibody variable domains with the pairings representing the structural characteristics of each amino acid position, wherein the consensus sequences for the hL6, hK4, hL4, hL5 and hH2 subgroups were derived from less than twenty actual light or heavy chain sequences.
In the consensus sequences set out in FIGS. 5A and 5B, upper case amino acid designations indicate that the amino acid is present at that location in about 90% to about 100% of the known human sequences (excluding small incomplete fragments) of that subgroup (i.e., is "highly conserved"); whereas lower case amino acid designations indicate that the amino acid is present at that location in about 50% to about 90% of the known human sequences in that subgroup (i.e., is "moderately conserved"). A lower case "x" denotes conservation in less than about 50% of the known sequences in that subgroup (i.e., a "poorly conserved" position).
The information presented in FIGS. 5A and 5B on the relationship of a particular amino acid in a sequence of an antibody variable domain to the structure and antigen-binding capacity of the domain is sufficient to determine whether an amino acid is modifiable.
Additional structural studies, such as those on which FIGS. 5A and 5B are based, are not required.
Thus, according to the present invention, FIGS. 5A and 5B may be used to prepare, for example, a modified mouse antibody variable domain that retains the affinity of the natural domain for antigen while exhibiting reduced immunogenicity in humans by the following steps. The amino acid sequences of both the light chain and the heavy chain from the mouse variable domain are first determined by techniques known in the art (e.g., by Edman degradation or by sequencing of a cDNA encoding the variable domain). Next, the consensus sequences set out in FIGS. 5A and 5B for human antibody variable regions are examined to identify both a light chain consensus and a heavy chain consensus sequence that are the most homologous to the particular mouse subunit sequences that are to be modified. The mouse sequences are aligned to the consensus human sequences based on homology either by sight or by using a commercially available computer program such as the PCGENE package (Intelligenetics, Mountain View, Calif.).
FIGS. 5A and 5B are then used again to identify all of the "low risk" or "moderate risk" positions at which the mouse sequence differs significantly from the chosen human consensus. The mouse amino acid residues at these low risk and moderate risk positions are candidates for modification. If the human consensus is strongly conserved at a given low risk or moderate risk position, the human residue may be substituted for the corresponding mouse residue. If the human consensus is poorly conserved at a given low risk or moderate risk position, the mouse residue is retained at that position. If the human consensus is moderately conserved at a specific position, the mouse residue is normally replaced with a human residue, unless the mouse residue occurs at that position in at least one of the sequences (e.g., in Kabat et al., supra) on which the human consensus sequence is based. If the mouse residue does occur at that position in a human sequence then the mouse residue may be retained.
Other criteria may be important to the determination of which identified residues of a variable region are to be modified. For example, since the side chain of proline is connected to both its .alpha.-carbon and its peptide nitrogen, free rotation is restricted around the carbon-nitrogen bond (the Ramachandran .phi. angle). Therefore, wherever there is a proline in a sequence, the shape of the backbone is distorted and that distortion can influence other residues involved in antigen binding. The presence or absence of a proline residue at any point in the amino acid sequence is a structurally important feature. If the mouse sequence contains a proline at a certain location, it is likely that its presence is necessary for a proper backbone and framework conformation and proline is preferably retained. If the mouse sequence does not contain a proline at a location where the human consensus sequence has one, it is likely that substituting a proline in the mouse sequence would affect proper conformation of the sequence, therefore the mouse residue is preferably retained. Where a proline at a particular position involving proline is changed from mouse to human, such a change is considered to be at least moderate risk even if that position would otherwise be low risk.
Similarly, insertions and deletions in a mouse sequence, relative to a human consensus framework, are normally preserved intact. If the mouse sequence has an alteration in the length and spacing of the variable region backbone, it is likely that the alteration is necessary to provide a surface for proper folding of the antigen-binding loops. The alteration is preferably retained in a modified version of the sequence.
Residues participating in the interface between the light and heavy chains of a variable domain are also preferably left intact in a modified version. They are all designated high risk, with =symbols on the "bury" lines in FIGS. 1, 5, 6, 10. The side chains in the interface region are buried deep within the structure, so they are unlikely to elicit a therapeutic immunogenic response in a heterologous species.
Once a modified sequence has been designed, DNAs encoding the complete variable domain are synthesized [via oligonucleotide synthesis as described, for example, in Sinha et al., Nucleic Acids Res., 12, 4539-4557 (1984)], assembled [via PCR as described, for example in Innis, Ed., PCR Protocols, Academic Press (1990) and also in Better et al. J. Biol. Chem. 267, 16712-16118 (1992)], cloned and expressed [via standard procedures as described, for example, in Ausubel et al., Eds., Current Protocols in Molecular Biology, John Wiley & Sons, New York (1989) and also in Robinson et al., Hum. Antibod. Hybridomas, 2, 84-93 (1991)], and finally tested for specific antigen binding activity [via competition assay as described, for example, in Harlow et al., Eds., Antibodies: A Laboratory Manual, Chapter 14, Cold Spring Harbor Laboratory, Cold Spring Harbor (1988) and Munson et al., Anal. Biochem., 107, 220-239 (1980)].
Treatment of certain autoimmune diseases with immunotoxin conjugates is described in co-pending, commonly assigned U.S. patent application Ser. No. 07/759,297 filed Sept. 13, 1991, and Bernhard, et al., "Materials Comprising and Methods of Preparation and Use for Ribosome-Inactivating Proteins", a United States patent application filed Dec. 9, 1992, which are incorporated herein by reference. An immunoglobulin such as an anti-T-cell immunoglobulin may be conjugated to a cytotoxic molecule. The cytotoxic molecule to which the immunoglobulin is conjugated may be any of a number of toxins such as lectin A or a ricin A chain. The above-referenced '297 application also describes use of an anti-CD5 antibody conjugated to a ricin A chain providing an anti-T-cell immunotoxin.
A general description of various autoimmune diseases is found in The Autoimmune Diseases (Rose & Mackey, eds 1985). Autoimmune diseases may be characterized, inter alia, by abnormal immunological regulation which results in excessive B Cell activity and diminished, enhanced, or inappropriate T Cell activity. Such altered T cell activity may result in excessive production of autoantibodies. Although the autoimmune diseases are complex and diverse in their manifestations, they possess the common feature of an impaired immune system. Therapeutic depletion of circulating T cells through the administration of an anti-pan T cell immunoglobulin improves the clinical course and prognosis of patients with autoimmune disease. For anti-CD5
antibody therapy, the additional depletion of CD5 B cells may have a further beneficial effect since CD5 B cells have been implicated in some autoimmune diseases.
Once prepared, humanized antibodies are then useful in the treatment of autoimmune disease. In this regard, an anti-CD5 monoclonal antibody is presented as an example of a preferred embodiment of the invention. An example of an anti-pan T cell immunoglobulin is an CD5 antibody which is primarily reactive with a surface antigen of mature T cells, but is also reactive with 10-20% of mature B cells. Clinical data obtained using the anti-pan T cell immunoglobulin in models of autoimmune diseases in non-human animals are predictive of the effects of using such immunoglobulins as therapy against human autoimmune diseases.
For the purpose of the present invention, an immunoglobulin, such as an antibody, is "reactive" with or "binds to" an antigen if it interacts with the antigen forms an antigen-immunoglobulin complex. The antigen is generally a unique surface protein or marker. A most preferred marker is the CD5 antigen cluster.
The anti-pan T cell immunoglobulin may be obtained from a number of sources. It is reactive with most mature T cells or with both T cells and subsets of other lymphoid cells, such as B cells or natural killer (NK) cells. The immunoglobulin may be synthetic or recombinant, including genetically-engineered immunoglobulins such as chimeric immunoglobulins, humanized antibodies, hybrid antibodies, or derivatives of any of these.
Chimeric immunoglobulins, antibodies or peptides are comprised of fused portions from different species as a product of chimeric DNA. Chimeric DNA is recombinant DNA containing genetic material from more than one mammalian species. Chimeric immunoglobulins include one portion having an amino acid sequence derived from, or homologous to, a corresponding sequence in an immunoglobulin, antibody or peptide derived from a first gene source while the remaining segment of the chain(s) is homologous to corresponding sequences of another gene source. For example, a chimeric antibody peptide may comprise an antibody heavy chain with a murine variable region and a human constant region. The two gene sources will typically involve two species, but will occasionally involve different sources from one species.
Chimeric immunoglobulins, antibodies or peptides are typically produced using recombinant molecular and/or cellular techniques. Typically, chimeric antibodies have variable regions of both light and heavy chains that mimic the variable regions of antibodies derived from one mammalian species, while the constant portions are homologous to the sequences in antibodies derived from a second, different mammalian species.
The definition of chimeric antibody, however, is not limited to this example. A chimeric antibody is any antibody in which either or both of the heavy or light chains are composed of combinations of sequences mimicking the sequences in antibodies of different sources regardless of whether these sources are differing classes, differing antigen responses, or differing species of origin, and whether or not the fusion point is at the variable/constant boundary.
The terms "humanized," "human-like" or "human-engineered" refers to an immunoglobulin wherein the constant regions have at least about 80% or greater homology to human immunoglobulin, and wherein some of the nonhuman (i.e. murine) variable region amino acid residues may be modified to contain amino acid residues of human origin.
Humanized antibodies may be referred to as "reshaped" antibodies. Manipulation of the complementarity-determining regions (CDRs) is one means of manufacturing humanized antibodies. See, e.g., Jones, et al. Replacing the Complementarity- Determining Regions in a Human Antibody With Those From a Mouse, Nature 321:522-525 (1988); Riechmann, et al. Reshaping Human Antibodies For Therapy, Nature 332, 323-327 (1988). For a review article concerning chimeric and humanized antibodies, see Winter and Milstein, Man-Made Antibodies, Nature 349, 293-299 (1991).
Preferably, immunoglobulins of the present invention are monoclonal antibodies (hereinafter referred to as "MoAbs") of the IgM or IgG isotype of murine, human or other mammalian origin. Most preferably, the MoAb is reactive with the CD5 antigen found on both T and B cells. MoAbs of other animal species may be prepared using analogous non-human mammalian markers.
A variety of methods for producing MoAbs are known in the art. See, e.g., Goding, Monoclonal Antibodies; Principles and practice (2d ed., Academic Press 1986), which is incorporated herein by reference. Less preferred forms of immunoglobulins may be produced by methods well-known to those skilled in the art, such as by chromatographic purification of polyclonal sera to produce substantially monospecific antibody populations.
Monoclonal antibodies specifically directed against human CD5 antigen may be obtained by using combinations of immunogens and screening antigens which have only there human CD5 antigen in common or bay a screening assay designed to be specific for only anti-CD5 monoclonals. For example, production of monoclonal antibodies directed against CD5 may be accomplished by 1) immunization with human T cells expressing the CD5 antigen followed by screening of the resultant hybridomas for reactivity against a non-human cell line transfected with human CD5 (constructed in a manner similar to that described in Nishimura, et al., Eur. J. Immunol., 18:747-753 (1988)); 2)immunization with a non-human cell line transfected with human CD5 followed by screening of the resultant hybridomas for reactivity against a human T cell line expressing the CD5 antigen; 3) immunization with human or non-human cell lines expressing human CD5 followed by screening of the resultant hybridomas for ability to block reactivity of existing anti-CD5 monoclonals with a human T cell line; 4) immunization with human or non-human cell lines expressing human CD5 followed by screening of the resultant hybridomas for reactivity with purified native or recombinant CD5
antigen; or 5) immunization with a recombinant derivative of the human CD5 antigen followed by screening of the resultant hybridomas for reactivity against a human T cell line expressing CD5.
A preferred monoclonal antibody for use in this invention is produced by hybridoma cell line XMMLY-H65 (H65) deposited with the American Type Culture Collection in Rockville, Md. (A.T.C.C.) and given the Accession No. HB9286. A preferred antibody is prepared as disclosed herein using the humanized forms of the murine H65 antibody.
The generation of human MoAbs to a human antigen is also known in the art. See, e.g., Koda and Glassy, Hum. Antibod. Hybridomas, 1(1) 15-22 (1990). Generation of such MoAbs may be difficult with conventional techniques. Thus, it may be desirable to modify the antigen binding regions of the non-human antibodies, e.g., the F(ab').sub.2 or hypervariable regions, to human constant regions (Fc) or framework regions by recombinant DNA techniques to produce substantially human molecules using general modification methods described in, for example, U.S. Pat No. 4,816,397; and EP publications 173,494 and 239,400, which are incorporated herein by reference.
Alternatively, one may isolate DNA sequences which encode a human MoAb or portions thereof which specifically bind to the human T cell by screening a DNA library from human B cells according to the general protocols outlined by Huse et al., Science 246:1275-1281 (1989), Marks, et al., J. Mol. Biol. 222:581-597 (1991) which are incorporated herein by reference, and then cloning and amplifying the sequences which encode the antibody (or binding fragment) of the desired specificity.
In addition to the immunoglobulins specifically described herein, other "substantially homologous" modified immunoglobulins can be readily designed and manufactured utilizing various recombinant DNA techniques known to those skilled in the art. Modifications of the immunoglobulin genes may be readily accomplished by a variety of well-known techniques, such as site-directed mutagenesis. See, Gillman and Smith, Gene 8:81-97 (1979); Roberts, et al., Nature 328:731-734 (1987), both of which are incorporated herein by reference. Also, modifications which affect the binding affinity of the antibody may be selected using the general protocol outlined by McCafferty, et al., Nature 348:552-554 (1990), which is incorporated herein by reference.
In the present invention, an immunoglobulin, antibody, or peptide is specific for a T cell if it binds or is capable of binding T cells as determined by standard antibody-antigen or ligand-receptor assays. Examples of such assays include competitive assays, immunocytochemistry assays, saturation assays, or standard immunoassays such as ELISA, RIA and flow cytometric assays. This definition of specificity also applies to single heavy and/or light chains, CDRs, fusion proteins, or fragments of heavy and/or light chains, which bind T cells alone or are capable of binding T cells if properly incorporated into immunoglobulin conformation with complementary variable regions and constant regions as appropriate.
In some competition assays, the ability of an immunoglobulin, antibody, or peptide fragment to bind an antigen is determined by detecting the ability of the immunoglobulin, antibody, or peptide to compete with the binding of a compound known to bind the antigen. Numerous types of competitive assays are known and are discussed herein. Alternatively, assays which measure binding of a test compound in the absence of an inhibitor may also be used. For instance, the ability of a molecule or other compound to bind T cells can be detected by labelling the molecule of interest directly, or it may be unlabelled and detected indirectly using various sandwich assay formats. Numerous types of binding assays such as competitive binding assays are known. See, e.g., U.S. Pat. Nos. 3,376,110, 4,016,043; Harlow and Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Publications, N.Y. (1988), which are incorporated herein by reference.
Assays for measuring binding of a test compound to one component alone rather than using a competition assay are also available. For instance, immunoglobulins may be used to identify the presence of a T cell marker. Standard procedures for monoclonal antibody assays, such as ELISA, may be used see, Harlow and Lane, supra). For a review of various signal producing systems which may be used, see U.S. Pat. No. 4,391,904, which is incorporated herein by reference.
Other assay formats may involve the detection of the presence or absence of various physiological or chemical changes that result from an antigen-antibody interaction. See Receptor-Effector Coupling--A Practical Approach, (Hulme, ed., IRL Press, Oxford 1990), which is incorporated herein by reference.
Humanized antibodies of the present invention may be administered to patients having a disease having targetable cellular markers. Such disease include, but are not limited to, autoimmune diseases such as lupus (including systemic lupus erythematosus and lupus nephritis), scleroderma diseases (including lichen sclerosis, morphea and lichen planus), rheumatoid arthritis and the spondylarthropathies, thyroiditis, pemphigus vulgaris, diabetes mellitus type 1, progressive systemic sclerosis, aplastic anemia, myasthenia gravis, myositis including polymyositis and dermatomyositis, Sjogren's disease, collagen vascular disease, polyarteritis, inflammatory bowel disease (including Crohn's disease and ulcerative colitis), multiple sclerosis, psoriasis and primary biliary cirrhosis; diseases caused by viral infections; diseases caused by fungal infections; diseases caused by parasites; and the like.
Immunoglobulins, antibodies or peptides according to the invention may be administered to a patient either singly or in a cocktail containing two or more antibodies, other therapeutic agents, compositions, or the like, including, but not limited to, immunosuppressive agents, potentiators and side-effect relieving agents. Of particular interest are immunosuppressive agents useful in suppressing allergic or other undesired reactions of a host. Immunosuppressive agents include prednisone, prednisolone, dexamethasone, cyclophosphamide, cyclosporine, 6-mercaptopurine, methotrexate, azathioprine, and gamma globulin. All of these agents are administered in generally accepted efficacious dose ranges such as those disclosed in the Physician's Desk Reference, 41st Ed. (1987). In addition to immunosuppressive agents, other compounds such as an angiogenesis inhibitor may be administered with the anti-pan T immunoglobin. See Peacock, et al., Arthritis and Rheum. 35 (Suppl.), Abstract, for ACR meeting No. B141 (Sept. 1992).
In a preferred embodiment of the present invention, anti-pan T cell immunoglobulins may be formulated into various preparations such as injectable and topical forms. Parenteral formulations are preferred for use in the invention, most preferred is intramuscular (i.m.) or intravenous (i.v.) administration. The formulations containing therapeutically effective amounts of anti-pan T cell antibodies are either sterile liquid solutions, liquid suspensions or lyophilized versions and optionally contain stabilizers or excipients. Lyophilized compositions are reconstituted with suitable diluents, e.g., water for injection, saline, 0.3% glycine and the like, at a level of from about 0.01 mg/kg of host body weight to about 10 mg/kg or more of host body weight.
Typically, the pharmaceutical compositions containing anti-pan T cell immunoglobulins are administered in a therapeutically effective dose in a range of from about 0.01 mg/kg to about 5 mg/kg body weight of the treated animal. A preferred dose range of the anti-pan T cell antibody is from about 0.05 mg/kg to about 2 mg/kg body weight of the treated animal. The immunoglobulin dose is administered over either a single day or several days by daily intravenous infusion. For example, for a patient weighing 70 kg, about 0.7 mg to about 700 mg per day is a preferred dose. A more preferred dose is from about 3.5 mg to about 140 mg per day.
Anti-pan T cell immunoglobulin may be administered systemically by injection intramuscularly, subcutaneously, intrathecally, intraperitoneally, into vascular spaces, or into joints (e.g., intraarticular injection at a dosage of greater than about
1 .mu.g/cc joint fluid/day). The dose will be dependent upon the properties of the anti-pan T cell immunoglobulin employed, e.g., its activity and biological half-life, the concentration of anti-pan T cell antibody in the formulation, the site and rate of dosage, the clinical tolerance of the patient involved, the autoimmune disease afflicting the patient and the like as is well within the knowledge of the skilled artisan.
The anti-pan T cell immunoglobulin of the present invention may be administered in solution. 5 The pH of the solution should be in the range of about pH 5.0 to about 9.5, preferably pH 6.5 to 7.5. The anti-pan T cell immunoglobulin or derivatives thereof should be in a solution having a pharmaceutically acceptable buffer, such as phosphate, tris (hydroxymethyl) aminomethane-HCl, or citrate and the like. Buffer concentrations should be in the range from about 1 to about 100 mM. A solution containing anti-pan T cell immunoglobulin may also contain a salt, such as sodium chloride or potassium chloride in a concentration from about 50 to about 150 mM. An effective amount of a stabilizing agent such as albumin, a globulin, a detergent, a gelatin, a protamine, or a salt of protamine may also be included and may be added to a solution containing anti-pan T cell immunoglobulin or to the composition from which the solution is prepared. Systemic administration of anti-pan T cell immunoglobulin is typically made every two to three days or once a week if a chimeric or humanized form is used. Alternatively, daily administration is useful. Usually administration is by either intramuscular injection or intravascular infusion.
Alternatively, anti-pan T cell immunoglobulin is formulated into topical preparations for local therapy by including a therapeutically effective concentration of anti-pan T cell immunoglobulin in a dermatological vehicle. Topical preparations may be useful to treat skin lesions such as psoriasis and dermatitis associated with lupus. The amount of anti-pan T cell immunoglobulin to be administered, and the anti-pan T cell immunoglobulin concentration in the topical formulations, will depend upon the vehicle selected, the clinical condition of the patient, the systemic toxicity and the stability of the anti-pan T cell immunoglobulin in the formulation. Thus, the physician will necessarily employ the appropriate preparation containing the appropriate concentration of anti-pan T cell immunoglobulin in the formulation, as well as the amount of formulation administered depending upon clinical experience with the patient in question or with similar patients.
The concentration of anti-pan T cell immunoglobulin for topical formulations is in the range from about 0.1 mg/ml to about 25 mg/ml. Typically, the concentration of anti-pan T cell immunoglobulin for topical formulations is in the range from about 1 mg/ml to about 20 mg/ml. Solid dispersions of anti-pan T cell immunoglobulin as well as solubilized preparations may be used. Thus, the precise concentration to be used in the vehicle may be subject to modest experimental manipulation in order to optimize the therapeutic response. Greater than about 10 mg of anti-pan T cell immunoglobulin/100 grams of vehicle may be useful with 1% w/w hydrogel vehicles in the treatment of skin inflammation. Suitable vehicles, in addition to gels, are oil-in-water or water-in-oil emulsions using mineral oils, petrolatum, and the like.
Anti-pan T cell immunoglobulin maybe optionally administered topically by the use of a transdermal therapeutic system (Barry, Dermatological Formulations, p. 181 (1983)). While such topical delivery systems have been designed largely for transdermal administration of low molecular weight drugs, by definition they are capable of percutaneous delivery. They may be readily adapted to administration of anti-pan T cell immunoglobulin or derivatives thereof and associated therapeutic proteins by appropriate selection of the rate-controlling microporous membrane.
Preparations of anti-pan T cell immunoglobulin either for systemic or local delivery may be employed and may contain excipients as described above for parenteral administration and other excipients used in a topical preparation such as cosolvents, surfactants, oils, humectants, emollients, preservatives, stabilizers and antioxidants. Any pharmacologically acceptable buffer may be used, e.g., tris or phosphate buffers.
Administration may also be intranasal or by other nonparenteral routes. Anti-pan T cell immunoglobulin may also be administered via microspheres, liposomes or other microparticulate delivery systems placed in certain tissues including blood.
Anti-pan T cell immunoglobulin may also be administered by aerosol to achieve localized delivery to the lungs. This is accomplished by preparing an aqueous aerosol or liposomal preparation. A nonaqueous (e.g., fluorocarbon propellent) suspension may be used. Sonic nebulizers preferably are used in preparing aerosols. Sonic nebulizers minimize exposing the anti-pan T cell antibody or derivatives thereof to shear, which can result in degradation of anti-pan T cell immunoglobulin.
Ordinarily, an aqueous aerosol is made by formulating an aqueous solution or suspension of anti-pan T cell immunoglobulin together with conventional pharmaceutically acceptable carriers and stabilizers. The carriers and stabilizers will vary depending upon the requirements for the particular anti-pan T cell immunoglobulin, but typically include nonionic surfactants (Tweens, Pluronics, or polyethylene glycol), innocuous proteins such as serum albumin, sorbitan esters, oleic acid, lecithin, amino acids such as glycine, buffers, salts, sugars, or sugar alcohols. The formulations are sterile. Aerosols generally may be prepared from isotonic solutions.
Each of the foregoing methods are illustrated by way of the following examples, which are not to be construed as limiting the invention. All references cited herein are incorporated by reference.
EXAMPLES
EXAMPLE 1
A. Identification of Low Risk Residues in A Mouse Variable Domain
A method of the present invention was utilized to prepare modified antibody variable domains by identifying low risk residues in a mouse monoclonal antibody variable domain, designated H65, which may be modified without diminishing the native affinity of the domain for antigen while still reducing its immunogenicity with respect to humans.
The light and heavy chains of the variable domain of H65 were determined to most closely resemble the consensus sequences of subgroup 1 ("hK1") of the human kappa chains and subgroup 3 ("hH3") of the human heavy chains, respectively. The H65
V/J-segments of the light and heavy chain sequences are aligned with the two human subgroup consensus sequences in FIGS. 6A and 6B.
The H65 sequences are also contained in SEQ ID Nos. 26 and 28.
In FIGS. 6A and 6B, upper and lower case letters denote the degree of conservation at any given position. For example, an "A" indicates that alanine is present at that position in about 90% to about 100% of the known human sequences of that subgroup (excluding small, incomplete fragments); whereas an "a" indicates that alanine is present only about 50% to about 90% of the time at that position in known human sequences of that subgroup. A lower case "x" indicates conservation of the amino acid at that position less than about 50% of the time.
The line labelled "bind" shows which residues directly affect (-) or do not directly affect (+) antigen binding of CDR loops. The "bury" line indicates exposed (+), buried (-), or interfacial (=) residues. On either the "bind" or "bury" line, a "0" indicates a residue of intermediate significance in terms of antigen binding or placement of the residue, respectively.
FIGS. 6A and 6B reveal that the mouse H65 sequences differ from the human consensus sequences with which they are aligned at a total of 94 positions.
Sixty-nine of these differences occur at moderate-risk (15 positions) or high risk (54 positions) positions suggesting that the mouse residue at that position may be important for the function of the antibody. The "M/H" line of FIG. 6
specifically indicates which positions differ between the two pairs of aligned sequences. Based on the considerations of the level of risk and the degree of conservation of the human residue at each position presented in the foregoing paragraphs, those residues in the H65 sequences designated M or m in the M/H line are identified as residues to be kept "mouse" in a humanized sequence, while those designated H or h are identified as residues to be changed to "human."
Twenty-five differences occur at low risk positions at which the mouse and human sequences differ. At thirteen of those positions (designated "H" on the M/H lines of FIG. 6) the mouse residue aligns with a human consensus amino acid which is highly conserved. Therefore, the mouse residue at that position is identified as one to be changed to the conserved human residue.
At four low risk positions (designated "m") in which the mouse and the human sequences differ, the mouse residue aligns with a human consensus amino acid which is moderately conserved. However, since the mouse residue is found at that position in other actual sequences of human antibodies (in Kabat's sequences of Proteins of Immunoglobulin Interest), the positions are identified as ones to be kept "mouse." At seven low risk positions (designated "h"), the mouse residue aligns with a human consensus amino acid which is moderately conserved but the mouse residue is not found at that position in an actual human antibody sequence in the Kabat book. Therefore, those positions are identified as ones to be changed to "human."
At one low risk position (designated "m") in which the mouse and human sequences differ, the mouse residue aligns with a human consensus amino acid which is poorly conserved. Therefore, that position is identified as one to be kept "mouse." The "prop" lines of FIG. 6 set out the sequences of the light and heavy chains of the H65 antibody variable domain in which the residues identified by the methods of the present invention as those which may be modified without diminishing the native affinity of the H65 variable domain for CD5 are changed to human residues. Thus, the "prop" lines of FIGS. 6A and 6B set out the amino acid sequences of humanized light (SEQ ID NO: 27) and heavy chains (SEQ ID NO: 29) of the H65 antibody variable domain.
EXAMPLE 2
A. Synthesis of H65 V/J Segments of light and heavy chain
Based on the low risk humanized amino acid sequences of the. V/J-segments of the light and heavy chains of the H65 antibody variable domain described in Example 1, synthetic genes for heavy and light chain V/J-segments of H65 were synthesized. The humanized amino acid sequences were reverse-translated with the PCGENE package (Intelligenetics, Mountain View, Calif.). Amino acid codons for each position were chosen which were identical to the mouse codon at positions where the mouse amino acid residue was maintained, or which matched as closely as possible a codon in a native antibody gene based on those gene sequences published in Kabat et al, supra. For expression of humanized whole antibody in mammalian cells, polynucleotides encoding the native mouse leader sequences were included as part of the humanized genes. Each gene, heavy or light, was assembled from six overlapping oligonucleotides and amplified by PCR. Each oligonucleotide was synthesized with a Cyclone Model 8400 DNA Synthesizer (Milligen/Biosearch, Burlington, Mass.). Restriction sites were introduced into the amplified DNA segments for cloning into the final expression vectors for antibody genes (heavy or light). A SalI restriction site was introduced into each V-region upstream of the initiation codon, ATG. A BstEII restriction site was introduced into the 3'-end of the heavy chain J-region, while a HindIII site was introduced into the 3'-end of the light chain J-region.
B. Construction of the Gene Encoding the Humanized H65 Heavy Chain Variable Region
The humanized V- and J-segments of the heavy chain were assembled from six oligonucleotides, HUH-G1, HUH-G2, HUH-G3,HUH-G4, HUH-G5, and HUH-G6, the sequences of which are contained in FIG. 7B and in SEQ ID Nos. 36 to 41, respectively. The oligonucleotides were amplified with PCR primers H65G-2S and H65-G2 (SEQ ID Nos. 42 and 43, respectively). Oligonucleotides greater than 50 bp in length were purified on a 15% polyacrylamide gel in the presence of 25% urea. DNA strand extension and DNA amplification was accomplished with a Taq polymerase and the GeneAmp Kit used according to the manufacturer's instructions (Perkin-Elmer Cetus, Germany). Oligonucleotides containing the synthetic humanized antibody gene were mixed in pairs (HUH-G1+HUH-G2, HUH-G3 +HUH-G4, and HUH-G5 +HUH-G6) in 100 .mu.l reactions with 1 .mu.g of each DNA, 2.5 U Taq polymerase, 50 mM KCl, 10 mM TRIS-Cl pH 8.3, 1.5 mM MgCl.sub.2, and 200 uM each dNTP. The tube was incubated in a Coy TempCycler for 1 minute at 94.degree. C., 2 minutes at 55.degree. C. and 20 minutes at 72.degree. C. A portion of each reaction product (40 .mu.l) was mixed in pairs (HUH-G2,2 +HUH-G3,4; HUH-G3,4 +HUH-G5,6), 2.5 U Taq was added and the tubes were re-incubated at 94.degree. C. for 1 minute, 55.degree. C. for 2 minutes and 72.degree. C. for 20 minutes. The heavy chain gene was then assembled by mixing an equal amount of the HUH-G1,2,3,4 reaction product with the HUH-G3,4,5,6 reaction product and bringing the volume to 100
.mu.l of 2.5 U Taq, 50 mM KCl, 10 mM TRIS-Cl pH 8.3, 1.5 mM MgCl.sub.2, 200 uM each dNTP, and 0.5 .mu.g of each amplification primer H65G-2S and H65-G2. The reaction was overlaid with mineral oil, and the cycle profile used for amplification was: denaturation 94.degree. C. for 1 minute, annealing 55.degree. C. for 2 minutes, and primer extension at 72.degree. C. for 3 minutes. Primer extension was carried out for 30 cycles. The DNA sequence of the assembled V/J-region is contained in FIG. 8A and in SEQ ID NO: 46. The assembled V/J-region was cut with SalI and BstEII, purified by electrophoresis on an agarose gel, and assembled into a heavy chain expression vector, pING4612, which is similar to that described for heavy chain expression in Robinson et al., Hum. Antib. Hybridomas, 2, 84 (1991) and described in detail in co-pending, co-owned U.S. patent application Ser. No. 07/659,409 filed on Sept. 6, 1989, which is incorporated herein by reference.
C. Construction of the Gene Encoding the Humanized H65 Light Chain Variable Region
The humanized V- and J-segments of the light chain were also assembled from six oligonucleotides, $H65K-1, HUH-K1, HUH-K2, HUH-K3, HUH-K4 and HUH-K5, the sequences of which are contained in FIG. 7 and in SEQ ID NOs. 30 to 35, respectively. The oligonucleotides were amplified with PCR primers H65K-2S and JK1-HindIII (SEQ ID NOs. 44 and 45, respectively). Oligonucleotides containing the synthetic humanized antibody gene were mixed in pairs ($H65K-K1+HUH-K1, HUH-K2+HUH-K3, and HUH-K4 +HUH-K5) and incubated as described above for the heavy chain. A portion of each reaction product (40 .mu.l) was mixed in pairs ($H65K-1/HUH-K1+HUH-K2,3; HUH-K2,3+HUH-K4,5) and treated as above. The light chain gene was then assembled by amplifying the full length gene with PCR primers H65K-2S and JK1-HindIII as outlined above for the heavy chain. The DNA sequence of the assembled V/J-region is contained in FIG. 8B and in SEQ ID NO. 47. The assembled V/J-region was cut with SalI and HindIII, purified by electrophoresis on an agarose gel, and assembled into a light chain antibody expression vector, pING4614 similar to those described for light chain expression in Robinson et al., supra. and in U.S. patent application Ser. No. 07/659,409, supra.
D. Transient Expression of Humanized H65 IgG
Expression vectors containing the humanized H65 light chain and heavy chain sequences under the control of the Abelson Leukemia virus LTR promoter (described in Robinson et al., supra, and in U.S. patent application Ser. No. 07/659,409, supra) and 3' untranslated regions from human gamma-1(for heavy chain) and mouse kappa (for light chain) were transfected by lipofection into a CHO-K1 strain which expresses the SV40 T antigen. Following treatment with lipofection reagent (Bethesda Research Labs, Gaithersburg, Md.) plus DNA for 5 hours at 37.degree. C., Ham's F12 media containing fetal bovine serum (FBS, final FBS conc.=10%) was added and the cells were incubated for an additional 48 hours. Following this incubation period, the FBS-supplemented media was removed and replaced with serum-free media (HB-CHO) (Irvine Scientific, Irvine, Calif.) and the cells were incubated for an additional 7 days. As a control, the CHO-K1 cells were also transfected with chimeric H65 light chain and heavy chain (each consisting of unmodified mouse V/J-segments fused to a human C-segment) in expression vectors similar to those described above. Following incubation, the supernatants were collected and tested by ELISA for the presence of secreted IgG. All of the supernatants contained about 0.03-0.06 .mu.g/ml IgG.
EXAMPLE 3
The H65 antibody modified according to the methods of the present invention was tested to determine whether it retained native affinity for antigen. Its binding capability was compared to that of a chimeric H65 IgG antibody (consisting of the chimeric H65 light chain and heavy chain described in Example 2) which has the same affinity for CD5 as unmodified H65 mouse antibody.
A. Preparation of Humanized and Chimeric H65 IgG for Competition Binding
The humanized H65 (hH65) and chimeric H65 IgG (cH65) from transient transfections described above were concentrated from 4 ml to a final volume of 100 .mu.l by centrifugation using a Centricon 30 (Amicon, Amicon
Division of W. R. Grace and Co., Beverley, Mass.) at 4.degree. C. Both hH65 and cH65 concentrates were then washed once with 1.0 ml of phosphate buffered saline (PBS), pH 7.2 and reconcentrated to approximately 100 .mu.l. As a control, HB-CHO culture media-alone (CM) or media supplemented with purified cH65 (CM+cH65) was concentrated in a similar manner. The final concentrations of hH65 and cH65 were determined by ELISA (anti-human Kappa pre-coat, peroxidase-labelled anti-human gamma for detection) using chimeric IgG as a standard.
B. Radiolabelling of cH65 IgG
20 .mu.g of purified cH65 IgG was iodinated (1 mCi of Na.sup.125 I, Amersham, Arlington Heights, Ill.) using lactoperoxidase beads (Enzymobeads, BioRad Laboratories, Richmond, Calif.) in PBS. Iodination was allowed to proceed for 45 minutes at
23.degree. C. .sup.125 I-cH65 IgG was purified from unbound .sup.125 I by gel filtration using a Sephadex G-25-80 column. Concentration and specific activity was determined by measuring the TCA-precipitated counts before and after purification.
C. Competitive Binding of hH65 for cH65 IgG
Molt4-M cells, which express CD5 on their surface, were plated into 96 well V-bottom plates at a density of 3.times.10.sup.5 cells per well and pelleted by centrifugation. The medium was decanted, and 100 .mu.l of purified cH65 IgG at final concentrations from 200 nM to 0.0017 nM (diluted in 3-fold steps) in "BHD" (DMEM (Dulbecco's Modified Eagle's Medium) +1% BSA +10 mM Hepes, pH 7.2] (BHD) was added to each well, followed by 100 .mu.l of .sup.125 I-cH65 IgG (final concentration=0.1 nM) in BHD. For single point determinations, 50-100 .mu.l of the Centricon.RTM. concentrates were added to the wells as follows: hH65 (final concentration=0.54 nM), cH65 (final concentration=0.22 nM), CM +purified cH65 IgG (final concentration=30 nM) and CM alone. These were followed by addition of .sup.125 I-cH65 IgG (final concentration=0.1 nM). Binding was allowed to proceed for 5 hours at 4.degree. C. At the end of 5 hours, binding was terminated by three washes with ice cold BHD using centrifugation to pellet cells. Radioactivity was determined by solubilizing bound .sup.125 I-cH65 IgG with 1N NaOH and counting in a Beckman Gamma 8000 (Beckman Instruments, Fullerton, Calif.).
Purified cH65 IgG effectively displaced .sup.125 I-cH65 IgG binding with an ED.sub.50 of approximately 1.0 nM as shown in FIG. 9, wherein open circles indicate cH65, shaded squares indicate hH65 and shaded triangles indicate CM+purified cH65. The hH65 was as effective in displacing .sup.125 I-cH65 IgG as were purified cH65 and CM+purified cH65 IgG, at their respective concentrations. No competition was observed with CM as expected. These results demonstrate that the low-risk changes made in the course of modification of hH65 did not diminish the binding affinity of this antibody for the CD5 antigen.
EXAMPLE 4
The method of the present invention for preparing modified antibody variable domains by identifying modifiable amino acids was applied to the anti-TAC antibody variable domain sequence [SEQ ID Nos. 49 (light chain) and 53 (heavy chain)] and the resulting modified sequence is compared to the humanized anti-TAC antibody sequence [SEQ ID Nos. 51 (light chain) and 55 (heavy chain)] described in Queen et al., supra.
The results are shown in FIGS. 10A and 10B. The sequence modified according to the present invention [SEQ ID Nos. 50 (light chain) and 54 (heavy chain)] is shown on the lines labelled "prop," and the Queen humanized sequence is shown on lines labelled "Que." Modifications to the Queen humanized sequence were based on the human EU antibody sequence [SEQ ID Nos. 48 (light chain) and 52 (heavy chain)]. The comparison reveals many differences between the proposed sequence generated by the methods of the present invention and the Queen humanized sequence. The differences which are the most likely to affect binding activity of their humanized antibody are positions 4 (L vs. M), 15 (P vs. V), 36 (F vs. Y), 47 (W vs. L), 71 (Y vs. F), and 80 (A vs. P) in the light chain, as well as position 69 (L vs. I) in the heavy chain.
EXAMPLE 5
Active Modified Antibodies May Be Evolved Toward Human
If it is desirable to humanize an antibody variable domain beyond the changes identified above, further, higher-risk changes may be made to evolve the domain.
Higher-risk residues may be changed in a round of mutagenesis subsequent to the low risk changes, in smaller groups, so that deleterious mutations may be identified quickly and corrected before binding activity is abolished. (Low risk changes can be made all at once, with little fear of abolishing activity.)
For example, because in the three-dimensional model of each subunit, framework 1 and framework 3 (F1 and F3 in FIGS. 2 and 3) form semi-independent loops on the surface of the subunit, the moderate or high risk mutations may therefore be divided into four groups (consisting of F1 and F3 in the light subunit and F1 and F3 in the heavy subunit). Four different constructs may be made, each containing higher-risk "human" mutations in only one framework region with the other three frameworks left completely "mouse," and assayed for activity. This technique avoids the dilemma raised by other humanization methods in which all higher-risk changes are made at once, making it difficult to determine which of the many amino acid changes is responsible for affecting antigen-binding activity. The creation of antibodies according to the invention which possess moderate risk changes are described below.
EXAMPLE 6
Identification of Moderate Risk Residues in Mouse Variable Domain
The human consensus sequences in which moderate risk residues are converted from mouse residues to human residues are represented in FIGS. 16A and 16B as lines labelled hK1 (i.e., subgroup 1 of the human kappa chain) and hH3 (i.e., subgroup 3 of the human heavy chain). Symbols in this Figure, for conservation and for risk are used in accordance with FIGS. 6A and 6B.
In the line labelled "mod", a dot (.) represents a residue which may be mutated from "mouse" to "human" at moderate risk. There are 29 such moderate risk positions.
The mouse residue matches the human consensus residue more than 50% of the time at 131 positions (102 positions match 90%-100% and 29 positions match 50% to 90%). These positions were not changed.
The lines labelled M/H in FIGS. 16A and 16B indicate the 91 positions which differed significantly between the mouse and human sequences (i.e., where the human sequences have the mouse residue less than 50% of the time). Moderate risk positions, designated m in the M/H line, were kept "mouse"; whereas those designated H or h were changed to human. The 25 low risk positions which were already human-like or which were previously humanized (as described supra in Example 1) are designated " " in the M/H line. Finally, the 54 high risk positions in which the mouse and human residues did not match are designated M and are kept "mouse".
Fifteen differences occur at moderate risk positions at which the mouse and human sequences differ. At ten of those positions (designated "H" on the M/H lines of FIG. 6) the mouse residue aligns with a human consensus amino acid which is highly conserved. Therefore, the mouse residue at that position is identified as one to be changed to the conserved human residue.
At moderate risk positions (designated "m") in which the mouse and the human sequences differ, the mouse residue aligns with a human consensus amino acid which is moderately conserved. However, since the mouse residue is found at that position in other actual sequences of human antibodies (in Kabat's sequences of Proteins of Immunoglobulin Interest, the positions are identified as ones to be kept "mouse." Although there are no such positions in this particular sequence, such positions may occur in other antibodies.
At four moderate risk positions (designated "h"), the mouse residue aligns with a human consensus amino acid which is moderately conserved but the mouse residue is not found at that position in an actual human antibody sequence in Kabat, et al. Sequences of Proteins of Immunoglobulin Interest, supra. Therefore, that position is identified as ones to be changed to "human."
At one moderate risk position (designated "m") in which the mouse and human sequences differ, the mouse residue aligns with a human consensus amino acid which is poorly conserved. Therefore, that position is identified as one to be kept "mouse."
The humanized H65 heavy chain containing the moderate risk residues was assembled by a strategy similar to that for the low risk residues. The moderate-risk expression vector was assembled from intermediate vectors. The six oligonucleotide sequences (oligos), disclosed in FIG. 7B and labelled HUH-G11, HUH-G12, HUH-G3, HUH-G4, HUH-G5, and HUH-G6 (the sequences of HUH-G11 and HUH-G12 are set out in SEQ ID Nos. 56 and 57) were assembled by PCR. Oligonucleotides containing the synthetic humanized antibody gene were mixed in pairs (HUH-GI1+HUH-G12, HUH-G3+HUH-G4, and HUH-G5+HUH-G6) in a 100 .mu.l reaction with 1 .mu.g of each DNA and filled in as described above. A portion of each reaction product was mixed in pairs (HUH-G11, 12+HUH-G3,
4; HUH-G3, 4+HUH-G5, 6), 2.5 U Taq was added and samples were reincubated as described above. The in-J-region was assembled by mixing equal amounts of the HUH-Gi1, 12, 3, 4 reaction product with the HUH-G3, 4, 5, 6 product, followed by PCR with 0.5 ug of primers H65G-2S and H65-G2 as described above. The reaction product was cut with SalI and BstEII and cloned into the expression vector, similar to that described for heavy chain in Robinson et al., Hum. Antibod. Hybridomas 2:84 (1991), generating pING4617. That plasmid was sequenced with Sequenase (USB, Cleveland), revealing that two residues were altered (a G-A at position 288 and a A-T at position 312, numbered from the beginning of the leader sequence). The correct variable region was restored by substitution of this region from pING4612, generating the expected V-region sequence in pING4619.
An intermediate vector containing the other moderate-risk changes was constructed by PCR assembly of the oligos HUH-G13, HUH-G14, HUH-G15, and HUH-G16 (FIG. 7A and SEQ ID Nos: 58-61). Oligos HUH-G13+HUH-G14 and HUH-G15 +HUH-G16 were mixed and filled in with Vent polymerase (New England Biotabs) in a reaction containing 10 mM KCl, 20 mM TRIS pH 8.8, 10 mM (NH.sub.4).sub.2 SO.sub.2, 2mM MgSO.sub.4, 0.1% Triton X-100, 100 ng/ml BSA, 200 uM of each dNTP, and 2 units of Vent polymerase in a total volume of 100 .mu.l. The reaction mix was incubated at 94.degree. C. for 1 minute, followed by 2 minutes at 50.degree. C. and 20 minutes at 72.degree. C. The reaction products (40 .mu.l) were mixed and amplified with the oligonucleotides H65-G13 and H65-G2 with Vent polymerase in the same reaction buffer and amplified for 25 cycles with denaturation at 94.degree. C. for 1 minute, annealing at 50.degree. C. for 2 minutes and polymerization at 72.degree. C. for 3minutes. The reaction product was treated with T4 polymerase and then digested with AccI. The 274 base pair (bp) fragment was purified on an agarose gel and ligated along with the 141 bp SalI to AccI fragment from pING4619 into pUC18 cut with SalI and SmaI to generate pING4620. pING4620 contains the entire signal sequence, V-region, and J-region of the moderate-risk H65 heavy chain.
The final expression vector for the moderate-risk H65 heavy chain, pING4621, was assembled by cloning the SalI to BstEII fragment from pING4620 into the same expression vector described above.
EXAMPLE 7
A. Assembly of moderate-risk light chain
The moderate-risk humanized V- and J-segments of the light chain were assembled from six oligonucleotides, $H65K-1, HUH-K7, HUH-K6, HUH-K8, HUH-K4 and HUH-K5. The sequences of HUH-K7, HUH-K6 and HUH-K8 are set out in SEQ ID Nos. 62-64 and FIGS.
7 and 7A, respectively. The oligonucleotides were amplified with PCR primers H65K-2S and JK1-HindIII. Oligonucleotides containing the synthetic humanized antibody gene were mixed in pairs ($H65-K1+HUH-K7, HUH-K6+HUH-K4+HUH-K5) and incubated with Vent polymerase as described for the moderate-risk heavy chain. A portion of each reaction product (40 ul) was mixed in pairs ($H65H-K1/HUH-K7+HUH-K6, 8; HUH-K6, 8+HUH-K4, 5) and filled in as above. The light chain gene was then assembled by amplifying the full length gene with the PCR primers H65K-2S and JK1-HindIII with Vent polymerase for 25 cycles as outlined above. The assembled V/J region was cut with SalI and HindIII, purified by electrophoresis on an agarose gel, and assembled into a light chain antibody expression vector, pING4630.
B. Stable Transfection of Mouse Lymphoid Cells for the Production of He3 Antibody
The cell line Sp2/0 (American Type Culture Collection #CRL1581) was grown in Dulbecco's Modified Eagle Medium plus 4.5 g/l glucose (DMEM, Gibco) plus 10% fetal bovine serum. Media were supplemented with glutamine/penicillin/streptomycin (Irvine Scientific, Irvine, Calif.).
The electroporation method of Potter, H., et al., Proc. Natl. Acad. Sci., USA, 81:7161 (1984) was used. After transfection, cells were allowed to recover in complete DMEM for 24-48 hours, and then seeded at 10,000 to 50,000 cells per well in
96-well culture plates in the presence of selective medium. Histidinol (Sigma) selection was at 1.71 ug/ml, and mycophenolic acid (Calbiochem) was at 6 ug/ml plus 0.25 mg/ml xanthine (Sigma). The electroporation technique gave a transfection frequency of 1-10.times.10.sup.-5 for the Sp2/0 cells.
The He3 light chain expression plasmid pING4630 was linearized by digestion with PvuI restriction endonuclease and transfected into Sp2/0 cells, giving mycophenolic acid--resistant clones which were screened for light chain synthesis. The best 4
light chain--producing transfectants after outgrowth were pooled into 2 groups of 2 transfectants/pool and each pool was transfected with the-He3 heavy chain expression plasmid, pING4621, that had been linearized with PvuI. After selection with histidinol, the clone producing the most light plus heavy chain, Sp2/0-4630+4621 Clone C1718, secreted antibody at approximately 22 .mu.g/ul in the presence of 10.sup.-7 in dexamethasone in an overgrown culture in a T25 flask. This transfectoma has been deposited with the American Type Culture Collection, 1230 Parklawn Drive, Rockville, Md., 20852 on Dec. 1, 1992 as ATCC HB 11206.
C. Purification of He3 Antibody Secreted in Tissue Culture
Sp2/0-4630+4621 cells are grown in culture medium HB101 (Hana Biologics)+1% Fetal Bovine Serum, supplemented with 10 mM HEPES, 1.times.Glutamine-Pen-Strep (Irvine Scientific #9316). The spent medium is centrifuged at about 5,000.times.g for 20
minutes. The antibody level is measured by ELISA. Approximately 200 ml of cell culture supernatant is loaded onto a 2 ml Protein A-column (Sigma Chemicals), equiliberated with PBS (buffer 0.15M NaCl, 5 mM sodium phosphate, 1 mM potassium phosphate, buffer pH 7.2). The He3 antibody is eluted with a step pH gradient (pH 5.5, 4.5 and 2.5). A fraction containing He3 antibody (9% yield) but not bovine antibody, is neutralized with 1M Tris pH 8.5, and then concentrated 10-fold by Centrium 30 (Amicon) diluted 10-fold with PBS, reconcentrated 10-fold by Centricon 30, diluted 10-fold with PBS, and finally reconcentrated 10-fold. The antibody was stored in 0.25 ml aliquots at -20.degree. C.
D. Affinity Measurements of He3 IgG for CD5
The affinity of He3 for CD5 was determined using Molt-4M cells, which express CD5 on their surface and I.sup.125 -labeled chimeric H65 IgG in a competitive binding assay.
For this assay, 20 .mu.g of chimeric H65 IgG (cH65 IgG) was iodinated by exposure to 100 .mu.l lactoperoxidase-glucose oxidase immobilized beads (Enzymobeads, BioRad), 100 .mu.l of PBS, 1.0 mCi I.sup.125 (Amersham, IMS30), 50 .mu.l of 55 mM b-D-glucose for 45 minutes at 23.degree. C. The reaction was quenched by the addition of 20 .mu.l of 105 mM sodium metabisulfite and 120 mM potassium iodine followed by centrifugation for 1 minute to pellet the beads. .sup.125 I-cH65 IgG was purified by gel filtration using 7 mls of sephadex G25, using PBS (137 mM NaCl, 1.47 mM KH.sub.2 PO.sub.4, 8.1 mM Na.sub.2 HPO.sub.4, 2.68 mM KCl at pH 7.2-7.4) plus 0.1% BSA. .sup.125 I-cH65 IgG recovery and specific activity were determined by TCA precipitation.
Competitive binding was performed as follows: 100 .mu.l of Molt-4M cells were washed two times in ice cold DHB binding buffer (Dubellco's modified Eagle's medium (Gibco, 320-1965PJ), 1.0% BSA and 10 mM Hepes at pH 7.2.-7.4). Cells were resuspended in the same buffer, plated into 96 v-bottomed wells (Costar) at 3.times.10.sup.5 cells per well and pelleted at 4.degree. C. by centrifugation for 5 min at 1,000 rpm using a Beckman JS 4.2 rotor; 50 .mu.l of 2X-concentrated 0.1 nM .sup.125
I-cH65 IgG in DHB was then added to each well and competed with 50 .mu.l of 2X-concentrated cH65 IgG or humanized antibody in DHB at final antibody concentrations from 100 nM to 0.0017 nM. Humanized antibody was obtained from culture supernatants of Sp2/0 clone C1718 which expresses He3 IgG. The concentration of the antibody in the supernatants was established by ELISA using a chimeric antibody as a standard. Binding was allowed to proceed at 4.degree. C. for 5 hrs and was terminated by washing cells three times with 200 .mu.l of DHB binding buffer by centrifugation for 5 min at 1,000 rpm. All buffers and operations were at 4.degree. C. Radioactivity was determined by solubilizing cells in 100 .mu.l of 1.0M NaOH and counting in a Cobra II auto gamma counter (Packard). Data from binding experiments were analyzed by the weighted nonlinear least squares curve fitting program, MacLigand, a Macintosh version of the computer program "Ligand" from Munson, Analyt. Biochem., 107:220 (1980). Objective statistical criteria (F, test, extra sum squares principle) were used to evaluate goodness of fit and for discriminating between models. Nonspecific binding was treated as a parameter subject to error and was fitted simultaneously with other parameters.
The results of the competition binding assay are provided in FIG. 11. These results demonstrate that the moderate-risk changes made in He3 IgG result in an antibody with a higher affinity than the chimeric mouse-human form of this antibody (cH65) for it's targe, CD5. In this particular case, moderate risk changes appear to increase affinity slightly, but a decrease may be expected in most cases.
EXAMPLE 8
Preparation of XMMLY-H65 Anti-pan T Cell Immunoglobulin
The murine monoclonal antibody produced by cell line XMMLY-H65 (MoAbH65) is reactive with the human CD5 antigen. The cell line XMMLY-H65 was deposited with the American Type Culture Collection, 12301 Parklawn Drive, Rockville, Md., 20852 and designated Accession No. HB9286.
MoAb H65 was produced after immunization of BALB/c mice with the human T-cell line HSB-2 originally isolated from a patient with T-cell acute lymphocytic leukemia. Adams, et al. Can. Res. 28:1121 (1968). The murine myeloma cell line P3 7
NS/1-Ag-1-4 of Kohler et al. Ernr. J. Immunol. 6:292 (1976) was fused with spleen cells from an immunized mouse by the technique of Galfre et al., Nature 266:550 (1977). One of the resulting hybrid colonies was found to secrete a MoAb that recognizes a pan-T-lymphocyte antigen with a molecular weight of 67 kD, expressed on approximately 95% of peripheral T-lymphocytes [Knowles, Leukocyte Typing II, 1,(E. Reinherz, et al. eds., Springer Verlag (1986)). This antigen is not present on the surface of any other hematopoietic cells, and the antibody itself has been tested for binding to a large range of normal human tissues and found to be negative for all cells except for T-lymphocytes and a subpopulation of B lymphocytes.
The H65 antibody-producing hybrid cell line was cloned twice by limiting dilution and was grown as ascites tumors in BALB/c mice.
MoAb H65 was purified from mouse ascites by a modification of the method of Ey et al. Immunochem. 15:429 (1978). In brief, the thawed mouse ascites was filtered to remove lipid-like materials and was diluted with 2 to 3 volumes of 0.14M NaPO.sub.4, pH 8.0, before application onto an immobilized protein A-Sepharose column of appropriate size. The unbound materials were removed from the column by washing with 0.14M NaPO.sub.4, pH 8.0, until no further change in absorbance at 280 nm was seen. A series of column washes with 0.1M sodium citrate (pH 6.0, pH 5.0, pH 4.0, and pH 3.0) were then performed to elute bound antibody.
Peak fractions were pooled, adjusted to pH 7.0 with saturated Tris base, and concentrated by using a cell stirred with Amicon YM10 membrane (Amicon, Lexington, N.Y.). An antibody solution was then dialyzed against phosphate-buffered saline (PBS), pH 7.0, and was stored frozen at -70.degree. C.
MoAb H65 is of the IgG.sub.1 subclass, as determined by double diffusion in agar with the use of subclass-specific antisera (Miles-Yeda, Ltd. Rehovot, Israel). The serologic characteristics of this antibody and the biochemical characteristics of the gp67 (i.e., CD5) antigen were exa